PRGDB00044658 (Disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 66473096 (AC153125)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula clone mth2-74f16, complete sequence.

DNA Sequence

ATGGCTGTTGAATTTATTGGCAGTGCTCTTCTTTCAGCTTCCCTTCAGGTTGCATTTGACAGGTTGGCTTCTCCTGAAGTTGTGGACTACTTTCAAGGAAGAAAATTCAATGAGAAGCTTCTTAAGAAACTCAACATCATGTTTCTATCCATCAATGTTGTTATCGATGATGCGGAACAAAAGCAGATCAGAAATCAACAAGTGAAAGCATGGCTCGATGCTGTCAAAGATGTTGTGTTTGAAGCAGAAGATTTATTAGATGAAATTGACATTCAAGCCTTTCAATGCAAACTCGAAGGTGAATCTCAATCCAGTCCTAACAAGGTATGGAGTTTTTTGAATGTTTCTGCAAATTCATTTGACAAAGAAATTGAATCAAAGATGCAAGAAGTTCTTGAAAATTTAGAATATCTTGCTAGCAAAAAGGATATACTAGGTTTGAAAGAGGCTAGTAGTAGTACTAGTAGTGCTTTTGGTGTTGGATCATGTAGTCAAGTGTCGCGAAAATTGCCTTCCACATCTTTGCTCGGTGAAACCGTTTTATATGGTAGAGATGTTGACAAAGATATTATATTGAATTGGTTGATATCTCATACTGACAATGAAAAACAATTTTCTATAGTTTCTATTGTTGGTATGGGTGGGTTGGGTAAGACCTTGCTTGCTCAACACTTATATAATGACTCAAAGATGGTGGATGAATTTGATGTCAAAGCTTGGGTTTGTATTTCCGACGAATTCGATGTTTTCAAGGTAACAAGAGCGATTCTTGAGGATATCACCAGATCAACTGATGATAGTAGAGACTTAAATATGGTTCAAGAAAGGTTGAAGGAAAAATTGTCAGGGAGGAGATTTCTTCTTGTTTTGGATGATGTTTGGAATGAAAAATGTGACGAATGGGAATGTTTGCAGACTCCATTTAATTATGGAGCCCGTGGAAGCAAAATTATCGTCACTACGCGCAGTATGAGAGTTGCTTCTTCGACCATGCGGTCAACTAAAATACACCAGCTAGAGAGGTTAAAGGAAGAACATTGCTGGCTATTATTTTCTAAACATGCATTCCAAGATGAAAATCCTCAATTGAATCCTGAGTTGGGGGACATTGGTAAAAAGATAGTTGGAAAATGTACGGGATTACCTCTAGCCTTGAAAACAGTTGGAAGTCTCTTGTACACAAAATCATCTTTGGCGGAATGGAAAACTACACTGGAAAGCGAGATATGGGACTTACCTGAAGAGGTTAGCAATATTATCCCCGCTTTAAGACTGAGCTATCACCACCTTCCTTCTCATTTGAAGAGATGTTTTGGTTATTGCTCTTTATTTCCAAAAGATTATGTGTTTGATAAGAAGCATTTAATTTTATTATGGATGGCTGAAAATTTTCTACAATGTCCTCAACAAAGTAAGAGTATGGAAGAAATTGGCGAAGAGTACTTTGATGATCTGTTATTGAGATCTTTTTTTCAACAATCAAGTCAAGACAAAACATGTTTTGTCATGCATGATCTTCTCAATGATTTGGCAAAATATGTATGTGGTGCTTTTTGTTTCAGGTTGGAAGTTGAAGAAGCACAAAATTTATCGAAAGTTACTCGTCATTTTTCATTTTTAAGAAATAGATATGAATCTTCCAAGAGGTTTGAGGCCTTATGTAAAGCTGAAAGATTGCGTACATTTCTTCCATTTAGCAGGAATCGTAAAGTGCCATCTTTTCTCAATGAATTCTGGATGTCTGGCCCTTTGTTGCATGAGTTGCTTCCCAAGTTTAAGCTTTTACGCGCTTTATCTCTGTCTTGTTATGTGAATATGATCGAGGTTCCTGACACTATAGGAAATCTTAAACATCTCCGTTATCTCGACCTTTCTGATACAAACATAAAAAAGCTACCGGATTCAATATGTTTTCTCTTTAACTTGCAAACACTGAAGTTGAAGAATTGTCAATTTTTGAAGGAGTTGCCTTTAAAATTTCATAAACTCATTAATTTGCGTTATCTTGATTTTAGTGGAACTAAAGTGAGAAATATGCCAATGCATTTTGGAAAATTGAAGAATCTTCAAGTGTTGAATTCATTCTGTGTAGAAAAAGGTAGCGACTGTGAGTCCAATATTCAACAGTTAGGCGAACTAAATCTTCATGGAACACTATCAATTTCTGAGTTGCAGAATACTGTCAATCCCTTTGATGCATTGGCAACAAACTTGAAAAATAAAATACACATTGTGAAGCTAGAGTTAGAATGGAATGCAAACAATGAAAACTCGGTGCAAGAAAGGGAAGTGCTTGAGAAGCTACAACCTTCAGAACACTTGAAGGAACTATCAATTAGGAGCTATGGTGGAACAAGATTTCCATATTGGTTTGGAGATGATTCACTATCTAATTTGGTGTCCTTGAAGTTGAGTAACTGTGAAAAATGTCTCTTGTTGCCTCCTCTTGGAATTTTACCATCTCTCAAGAAACTAAGCATTATAGGGCTATCGAGTGTAGTGTTTATTGGCACCGAGTTTAATGGAAGTAGCTCTTCAACTGTTCCATTTCCATCCTTGGAAACTTTACAATTTGAGGATATGTATGAATGGGAAGAATGGGAATGCAAAACCATGACAAATGCTTTTCCACATCTTCAAAAGCTTTCTTTAAAAAATTGTCCAAATCTAAGAGAGTATTTACCAGAGAAACTTCTTGGTTTAATTATGCTAGAAGTTTCCCATTGTGAACAACTTGTGGCTTCTGTTCCTAGGACTCCATTCATTCATGAGTTACATCTGAATGATTGCGGAAAGCTTCAATTTGATTACCATCCAGCTACTTTGAAAATTCTCACGATTTCTGGATACTGCATGGAAGCATCACTGCTTGAGAGTATTGAGCCTATCATATCCAATATCTCTCTTGAAAGAATGAATATTAATTCTTGCCCGATGATGAACGTTCCAGTTCATTGTTGCTACAATTTCCTTGTAGGATTGTACATCTGGAGTAGTTGTGACTCTCTAATTACATTTCATCTTGATTTGTTCCCAAAATTAAAGGAGCTCCAGTTTAGAGACTGTAATAATCTTGAGATGGTTTCACAAGAGAAAACTCACAATCTCAAACTTTTTCAAATATCCAATTGTCCTAAATTCGTGTCATTTCCAAAAGGAGGACTCAATGCACCTGAGCTAGTAATGTGTCAATTTTATAAATCGGAGAACTTGAAATCATTGCCTGAATGCATGCACATTCTCCTTCCATCGATGTATCATCTAATAGTACAGGACTGTCTGCAACTAGAGTTGTTCTCTGATGGAGGTTTGCCTTCAAACTTAAAACAGTTGCATCTTCGCAATTGTTCCAAACTTTTGGCATCACTGAAATGCGCTTTGGCAACAACAACTTCTCTACTTTCTTTGTATATCGGAGAAGCGGATATGGAGTCTTTTCCTGATCAAGGGTTTTTTCCGCATTCTCTTACTTCCCTATCCATCACTTGGTGTCCAAATCTTAAGAGATTGAATTACTCGGGTCTCTCCCATCTCTCCTCTCTTACAAGATTGTATCTTTCCAGCAGCCCGTTACTCGAATGCTTACCAAAGGAGGGTCTGCCCAAATCCATTTCAACTCTACAAATCTGGGGCAACTGTCCATTGCTCAAACATCGTTTTCAAAAACCGAATGGAGAAGATTGGGAGAAGATTCGCCACATTCAATGCATAATAATTGACAACGAGATAATAACATGA


Protein sequences

Name Description Sequence
Disease resistance protein Disease resistance protein [Medicago truncatula].

MAVEFIGSALLSASLQVAFDRLASPEVVDYFQGRKFNEKLLKKLNIMFLSINVVIDDAEQKQIRNQQVKAWLDAVKDVVFEAEDLLDEIDIQAFQCKLEGESQSSPNKVWSFLNVSANSFDKEIESKMQEVLENLEYLASKKDILGLKEASSSTSSAFGVGSCSQVSRKLPSTSLLGETVLYGRDVDKDIILNWLISHTDNEKQFSIVSIVGMGGLGKTLLAQHLYNDSKMVDEFDVKAWVCISDEFDVFKVTRAILEDITRSTDDSRDLNMVQERLKEKLSGRRFLLVLDDVWNEKCDEWECLQTPFNYGARGSKIIVTTRSMRVASSTMRSTKIHQLERLKEEHCWLLFSKHAFQDENPQLNPELGDIGKKIVGKCTGLPLALKTVGSLLYTKSSLAEWKTTLESEIWDLPEEVSNIIPALRLSYHHLPSHLKRCFGYCSLFPKDYVFDKKHLILLWMAENFLQCPQQSKSMEEIGEEYFDDLLLRSFFQQSSQDKTCFVMHDLLNDLAKYVCGAFCFRLEVEEAQNLSKVTRHFSFLRNRYESSKRFEALCKAERLRTFLPFSRNRKVPSFLNEFWMSGPLLHELLPKFKLLRALSLSCYVNMIEVPDTIGNLKHLRYLDLSDTNIKKLPDSICFLFNLQTLKLKNCQFLKELPLKFHKLINLRYLDFSGTKVRNMPMHFGKLKNLQVLNSFCVEKGSDCESNIQQLGELNLHGTLSISELQNTVNPFDALATNLKNKIHIVKLELEWNANNENSVQEREVLEKLQPSEHLKELSIRSYGGTRFPYWFGDDSLSNLVSLKLSNCEKCLLLPPLGILPSLKKLSIIGLSSVVFIGTEFNGSSSSTVPFPSLETLQFEDMYEWEEWECKTMTNAFPHLQKLSLKNCPNLREYLPEKLLGLIMLEVSHCEQLVASVPRTPFIHELHLNDCGKLQFDYHPATLKILTISGYCMEASLLESIEPIISNISLERMNINSCPMMNVPVHCCYNFLVGLYIWSSCDSLITFHLDLFPKLKELQFRDCNNLEMVSQEKTHNLKLFQISNCPKFVSFPKGGLNAPELVMCQFYKSENLKSLPECMHILLPSMYHLIVQDCLQLELFSDGGLPSNLKQLHLRNCSKLLASLKCALATTTSLLSLYIGEADMESFPDQGFFPHSLTSLSITWCPNLKRLNYSGLSHLSSLTRLYLSSSPLLECLPKEGLPKSISTLQIWGNCPLLKHRFQKPNGEDWEKIRHIQCIIIDNEIIT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-970 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSASLQVAFDRLASPEVVDYFQGRKFNEKLLKKLNIMFLSINVVIDDAEQKQIRNQQVKAWLDAVKDVVFEAEDLLDEIDIQAFQCKLEGESQSSPNKVWSFLNVSANSFDKEIESKMQEVLENLEYLASKKDILGLKEASSSTSSAFGVGSCSQVSRKLPSTSLLGETVLYGRDVDKDIILNWLISHTDNEKQFSIVSIVGMGGLGKTLLAQHLYNDSKMVDEFDVKAWVCISDEFDVFKVTRAILEDITRSTDDSRDLNMVQERLKEKLSGRRFLLVLDDVWNEKCDEWECLQTPFNYGARGSKIIVTTRSMRVASSTMRSTKIHQLERLKEEHCWLLFSKHAFQDENPQLNPELGDIGKKIVGKCTGLPLALKTVGSLLYTKSSLAEWKTTLESEIWDLPEEVSNIIPALRLSYHHLPSHLKRCFGYCSLFPKDYVFDKKHLILLWMAENFLQCPQQSKSMEEIGEEYFDDLLLRSFFQQSSQDKTCFVMHDLLNDLAKYVCGAFCFRLEVEEAQNLSKVTRHFSFLRNRYESSKRFEALCKAERLRTFLPFSRNRKVPSFLNEFWMSGPLLHELLPKFKLLRALSLSCYVNMIEVPDTIGNLKHLRYLDLSDTNIKKLPDSICFLFNLQTLKLKNCQFLKELPLKFHKLINLRYLDFSGTKVRNMPMHFGKLKNLQVLNSFCVEKGSDCESNIQQLGELNLHGTLSISELQNTVNPFDALATNLKNKIHIVKLELEWNANNENSVQEREVLEKLQPSEHLKELSIRSYGGTRFPYWFGDDSLSNLVSLKLSNCEKCLLLPPLGILPSLKKLSIIGLSSVVFIGTEFNGSSSSTVPFPSLETLQFEDMYEWEEWECKTMTNAFPHLQKLSLKNCPNLREYLPEKLLGLIMLEVSHCEQLVASVPRTPFIHELHLNDCGKLQFDYHPATLKILTISGYCMEASLLESIEPIISNISLE

HMMPanther: PTHR23155:SF236
11-970 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

LSASLQVAFDRLASPEVVDYFQGRKFNEKLLKKLNIMFLSINVVIDDAEQKQIRNQQVKAWLDAVKDVVFEAEDLLDEIDIQAFQCKLEGESQSSPNKVWSFLNVSANSFDKEIESKMQEVLENLEYLASKKDILGLKEASSSTSSAFGVGSCSQVSRKLPSTSLLGETVLYGRDVDKDIILNWLISHTDNEKQFSIVSIVGMGGLGKTLLAQHLYNDSKMVDEFDVKAWVCISDEFDVFKVTRAILEDITRSTDDSRDLNMVQERLKEKLSGRRFLLVLDDVWNEKCDEWECLQTPFNYGARGSKIIVTTRSMRVASSTMRSTKIHQLERLKEEHCWLLFSKHAFQDENPQLNPELGDIGKKIVGKCTGLPLALKTVGSLLYTKSSLAEWKTTLESEIWDLPEEVSNIIPALRLSYHHLPSHLKRCFGYCSLFPKDYVFDKKHLILLWMAENFLQCPQQSKSMEEIGEEYFDDLLLRSFFQQSSQDKTCFVMHDLLNDLAKYVCGAFCFRLEVEEAQNLSKVTRHFSFLRNRYESSKRFEALCKAERLRTFLPFSRNRKVPSFLNEFWMSGPLLHELLPKFKLLRALSLSCYVNMIEVPDTIGNLKHLRYLDLSDTNIKKLPDSICFLFNLQTLKLKNCQFLKELPLKFHKLINLRYLDFSGTKVRNMPMHFGKLKNLQVLNSFCVEKGSDCESNIQQLGELNLHGTLSISELQNTVNPFDALATNLKNKIHIVKLELEWNANNENSVQEREVLEKLQPSEHLKELSIRSYGGTRFPYWFGDDSLSNLVSLKLSNCEKCLLLPPLGILPSLKKLSIIGLSSVVFIGTEFNGSSSSTVPFPSLETLQFEDMYEWEEWECKTMTNAFPHLQKLSLKNCPNLREYLPEKLLGLIMLEVSHCEQLVASVPRTPFIHELHLNDCGKLQFDYHPATLKILTISGYCMEASLLESIEPIISNISLE

superfamily: SSF52540
164-416 SSF52540

SQVSRKLPSTSLLGETVLYGRDVDKDIILNWLISHTDNEKQFSIVSIVGMGGLGKTLLAQHLYNDSKMVDEFDVKAWVCISDEFDVFKVTRAILEDITRSTDDSRDLNMVQERLKEKLSGRRFLLVLDDVWNEKCDEWECLQTPFNYGARGSKIIVTTRSMRVASSTMRSTKIHQLERLKEEHCWLLFSKHAFQDENPQLNPELGDIGKKIVGKCTGLPLALKTVGSLLYTKSSLAEWKTTLESEIWDLPEEV

Gene3D: G3DSA:3.40.50.300
184-327 G3DSA:3.40.50.300

RDVDKDIILNWLISHTDNEKQFSIVSIVGMGGLGKTLLAQHLYNDSKMVDEFDVKAWVCISDEFDVFKVTRAILEDITRSTDDSRDLNMVQERLKEKLSGRRFLLVLDDVWNEKCDEWECLQTPFNYGARGSKIIVTTRSMRVA

HMMPfam: PF00931
IPR002182
188-466 NB-ARC,NBS
NB-ARC

KDIILNWLISHTDNEKQFSIVSIVGMGGLGKTLLAQHLYNDSKMVDEFDVKAWVCISDEFDVFKVTRAILEDITRSTDDSRDLNMVQERLKEKLSGRRFLLVLDDVWNEKCDEWECLQTPFNYGARGSKIIVTTRSMRVASSTMRSTKIHQLERLKEEHCWLLFSKHAFQDENPQLNPELGDIGKKIVGKCTGLPLALKTVGSLLYTKSSLAEWKTTLESEIWDLPEEVSNIIPALRLSYHHLPSHLKRCFGYCSLFPKDYVFDKKHLILLWMAENFLQ

FPrintScan: PR00364
IPR000767
207-222 DISEASERSIST
Disease resistance protein

IVSIVGMGGLGKTLLA

FPrintScan: PR00364
IPR000767
280-294 DISEASERSIST
Disease resistance protein

KLSGRRFLLVLDDVW

FPrintScan: PR00364
IPR000767
378-392 DISEASERSIST
Disease resistance protein

CTGLPLALKTVGSLL

superfamily: SSF52058
502-912 SSF52058,LRR

VMHDLLNDLAKYVCGAFCFRLEVEEAQNLSKVTRHFSFLRNRYESSKRFEALCKAERLRTFLPFSRNRKVPSFLNEFWMSGPLLHELLPKFKLLRALSLSCYVNMIEVPDTIGNLKHLRYLDLSDTNIKKLPDSICFLFNLQTLKLKNCQFLKELPLKFHKLINLRYLDFSGTKVRNMPMHFGKLKNLQVLNSFCVEKGSDCESNIQQLGELNLHGTLSISELQNTVNPFDALATNLKNKIHIVKLELEWNANNENSVQEREVLEKLQPSEHLKELSIRSYGGTRFPYWFGDDSLSNLVSLKLSNCEKCLLLPPLGILPSLKKLSIIGLSSVVFIGTEFNGSSSSTVPFPSLETLQFEDMYEWEEWECKTMTNAFPHLQKLSLKNCPNLREYLPEKLLGLIMLEVSHCEQL

Gene3D: G3DSA:3.80.10.10
546-779 G3DSA:3.80.10.10

SSKRFEALCKAERLRTFLPFSRNRKVPSFLNEFWMSGPLLHELLPKFKLLRALSLSCYVNMIEVPDTIGNLKHLRYLDLSDTNIKKLPDSICFLFNLQTLKLKNCQFLKELPLKFHKLINLRYLDFSGTKVRNMPMHFGKLKNLQVLNSFCVEKGSDCESNIQQLGELNLHGTLSISELQNTVNPFDALATNLKNKIHIVKLELEWNANNENSVQEREVLEKLQPSEHLKELSI

FPrintScan: PR00364
IPR000767
614-630 DISEASERSIST
Disease resistance protein

GNLKHLRYLDLSDTNIK

HMMPfam: PF00560
IPR001611
618-637 LRR_1
Leucine-rich repeat

HLRYLDLSDTNIKKLPDSIC

ProfileScan: PS51450
IPR001611
618-639 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLDLSDTNIKKLPDSICFL

ProfileScan: PS51450
IPR001611
641-662 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLKLKNCQFLKELPLKFHK

ProfileScan: PS51450
IPR001611
665-687 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRYLDFSGTKVRNMPMHFGKLK

Gene3D: G3DSA:3.80.10.10
794-979 G3DSA:3.80.10.10

DSLSNLVSLKLSNCEKCLLLPPLGILPSLKKLSIIGLSSVVFIGTEFNGSSSSTVPFPSLETLQFEDMYEWEEWECKTMTNAFPHLQKLSLKNCPNLREYLPEKLLGLIMLEVSHCEQLVASVPRTPFIHELHLNDCGKLQFDYHPATLKILTISGYCMEASLLESIEPIISNISLERMNINSCPM

superfamily: SSF52058
957-1233 SSF52058,LRR

LESIEPIISNISLERMNINSCPMMNVPVHCCYNFLVGLYIWSSCDSLITFHLDLFPKLKELQFRDCNNLEMVSQEKTHNLKLFQISNCPKFVSFPKGGLNAPELVMCQFYKSENLKSLPECMHILLPSMYHLIVQDCLQLELFSDGGLPSNLKQLHLRNCSKLLASLKCALATTTSLLSLYIGEADMESFPDQGFFPHSLTSLSITWCPNLKRLNYSGLSHLSSLTRLYLSSSPLLECLPKEGLPKSISTLQIWGNCPLLKHRFQKPNGEDWEKIRH

Gene3D: G3DSA:3.80.10.10
1069-1212 G3DSA:3.80.10.10

ENLKSLPECMHILLPSMYHLIVQDCLQLELFSDGGLPSNLKQLHLRNCSKLLASLKCALATTTSLLSLYIGEADMESFPDQGFFPHSLTSLSITWCPNLKRLNYSGLSHLSSLTRLYLSSSPLLECLPKEGLPKSISTLQIWGN

ProfileScan: PS51450
IPR001611
1166-1185 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKRLNYSGLSHLSSLTRLY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox