PRGDB00044659 (TIR; Disease resistance protein)

From PRG Wiki
Jump to: navigation, search
TIR; Disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 100912984 (AC183371)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula chromosome 7 clone mth2-9g15, complete sequence.

DNA Sequence

ATGGCTTCCTCCAGTTCTACTTCCAGCACCAACTTATTTGTTGCGGACCATCCAGTGGGGGTGGAATCTCGTGTACAAGAGGTTATTCAACTACTAAAATCCCGACAATCAGAAGATCCTGTACTGCTTGGGATATGGGGCGGAGGAGGGATCGGTAAAACAACAATTGCCAAAGCAGTTTATAATGAAATCCATCGCCACCATTTTGAGGCAAGGAGCTTCCTCTTAAATGTCGGTGAAGTTTGGAAACAAGATAATGGCGAAGTTTCTTTACAAAAACAACTTATTTCTGTTATCAGAAGCAGCAGCAGAAGAATAACGATAAATACAGTTGAATCCGGAAAAAGGATATTGCAGGAGAGGCTTCCCCGTTGGAAGATATTACTTGTGGTTGACGATGTGAATAAAAAAGACCAATTGGGTGCTTTGTGCATAAGACGCAAATGGTTTGGTCAAGGAAGTATAATAATCATCACAACGAGAGATCATGATTTACTTCGGTGGCTTCAGGTGGACCATGAAAGGTTCTATGATGTGTTCTTGAGTTTCAGAGGGAAAGATACTCGCGAAAGATTGACTTCACATCTCTATACCTCTCTTCAAAATGCTGGAATTTATGTTTTTAGAGACGATAATGAGATTCAACCAGGAGAAAAGATCTCAGTCTACCTTTTGGAAGCAATTAGACAGTATAGAATTTGTATTGTTGTTTTGTATAGTAATTATGCTAGTTCAAACTGGCGTATGCAAGAGTTGGAGGAAATCATGAAATGTCGCAGACGCTGGGGTTTGGTGGTTATACCAGTGTTTTATGAGGTAGATCCCTCAGAAGTAGAACATCAAACCGGTTGGTTTGGAGACGGTTTTGAAAGACTCATCTCAAGAATCTCAATGCGTAACGATATGAGAAGGAATTGGAAAGAAATGCTCCTTGAAATCGGTGGCATAGCAGGGTTTATCTTCCCAAATTCAAGGAATGGGAATGAGTATATCAGGATACTAGTGGAGCATGTTAAGAGCAGACTTAGTCAAAGTGGACCATTCTATTGA


Protein sequences

Name Description Sequence
TIR; Disease resistance protein TIR; Disease resistance protein [Medicago truncatula].

MASSSSTSSTNLFVADHPVGVESRVQEVIQLLKSRQSEDPVLLGIWGGGGIGKTTIAKAVYNEIHRHHFEARSFLLNVGEVWKQDNGEVSLQKQLISVIRSSSRRITINTVESGKRILQERLPRWKILLVVDDVNKKDQLGALCIRRKWFGQGSIIIITTRDHDLLRWLQVDHERFYDVFLSFRGKDTRERLTSHLYTSLQNAGIYVFRDDNEIQPGEKISVYLLEAIRQYRICIVVLYSNYASSNWRMQELEEIMKCRRRWGLVVIPVFYEVDPSEVEHQTGWFGDGFERLISRISMRNDMRRNWKEMLLEIGGIAGFIFPNSRNGNEYIRILVEHVKSRLSQSGPFY

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
13-231 SSF52540

FVADHPVGVESRVQEVIQLLKSRQSEDPVLLGIWGGGGIGKTTIAKAVYNEIHRHHFEARSFLLNVGEVWKQDNGEVSLQKQLISVIRSSSRRITINTVESGKRILQERLPRWKILLVVDDVNKKDQLGALCIRRKWFGQGSIIIITTRDHDLLRWLQVDHERFYDVFLSFRGKDTRERLTSHLYTSLQNAGIYVFRDDNEIQPGEKISVYLLEAIRQY

HMMPfam: PF00931
IPR002182
22-174 NB-ARC,NBS
NB-ARC

ESRVQEVIQLLKSRQSEDPVLLGIWGGGGIGKTTIAKAVYNEIHRHHFEARSFLLNVGEVWKQDNGEVSLQKQLISVIRSSSRRITINTVESGKRILQERLPRWKILLVVDDVNKKDQLGALCIRRKWFGQGSIIIITTRDHDLLRWLQVDHE

Gene3D: G3DSA:3.40.50.300
26-161 G3DSA:3.40.50.300

QEVIQLLKSRQSEDPVLLGIWGGGGIGKTTIAKAVYNEIHRHHFEARSFLLNVGEVWKQDNGEVSLQKQLISVIRSSSRRITINTVESGKRILQERLPRWKILLVVDDVNKKDQLGALCIRRKWFGQGSIIIITTR

HMMSmart: SM00382
IPR003593
39-202 AAA,NBS
AAA+ ATPase domain

DPVLLGIWGGGGIGKTTIAKAVYNEIHRHHFEARSFLLNVGEVWKQDNGEVSLQKQLISVIRSSSRRITINTVESGKRILQERLPRWKILLVVDDVNKKDQLGALCIRRKWFGQGSIIIITTRDHDLLRWLQVDHERFYDVFLSFRGKDTRERLTSHLYTSLQN

FPrintScan: PR00364
IPR000767
42-57 DISEASERSIST
Disease resistance protein

LLGIWGGGGIGKTTIA

HMMPanther: PTHR11017
44-179 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GIWGGGGIGKTTIAKAVYNEIHRHHFEARSFLLNVGEVWKQDNGEVSLQKQLISVIRSSSRRITINTVESGKRILQERLPRWKILLVVDDVNKKDQLGALCIRRKWFGQGSIIIITTRDHDLLRWLQVDHERFYDV

HMMPanther: PTHR11017:SF20
44-179 PTHR11017:SF20,SUBFAMILY NOT NAMED

GIWGGGGIGKTTIAKAVYNEIHRHHFEARSFLLNVGEVWKQDNGEVSLQKQLISVIRSSSRRITINTVESGKRILQERLPRWKILLVVDDVNKKDQLGALCIRRKWFGQGSIIIITTRDHDLLRWLQVDHERFYDV

FPrintScan: PR00364
IPR000767
121-135 DISEASERSIST
Disease resistance protein

RLPRWKILLVVDDVN

superfamily: SSF52200
IPR000157
165-319 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LLRWLQVDHERFYDVFLSFRGKDTRERLTSHLYTSLQNAGIYVFRDDNEIQPGEKISVYLLEAIRQYRICIVVLYSNYASSNWRMQELEEIMKCRRRWGLVVIPVFYEVDPSEVEHQTGWFGDGFERLISRISMRNDMRRNWKEMLLEIGGIAGF

Gene3D: G3DSA:3.40.50.10140
174-291 G3DSA:3.40.50.10140

ERFYDVFLSFRGKDTRERLTSHLYTSLQNAGIYVFRDDNEIQPGEKISVYLLEAIRQYRICIVVLYSNYASSNWRMQELEEIMKCRRRWGLVVIPVFYEVDPSEVEHQTGWFGDGFER

ProfileScan: PS50104
IPR000157
175-316 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RFYDVFLSFRGKDTRERLTSHLYTSLQNAGIYVFRDDNEIQPGEKISVYLLEAIRQYRICIVVLYSNYASSNWRMQELEEIMKCRRRWGLVVIPVFYEVDPSEVEHQTGWFGDGFERLISRISMRNDMRRNWKEMLLEIGGI

HMMSmart: SM00255
IPR000157
176-316 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FYDVFLSFRGKDTRERLTSHLYTSLQNAGIYVFRDDNEIQPGEKISVYLLEAIRQYRICIVVLYSNYASSNWRMQELEEIMKCRRRWGLVVIPVFYEVDPSEVEHQTGWFGDGFERLISRISMRNDMRRNWKEMLLEIGGI

HMMPfam: PF01582
IPR000157
179-310 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGKDTRERLTSHLYTSLQNAGIYVFRDDNEIQPGEKISVYLLEAIRQYRICIVVLYSNYASSNWRMQELEEIMKCRRRWGLVVIPVFYEVDPSEVEHQTGWFGDGFERLISRISMRNDMRRNWKEML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox