PRGDB00044661 (Disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 62701972 (AC160012)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula chromosome 2 clone mth2-168l8, complete sequence.

DNA Sequence

ATGGCTGCTGAATTTGTTGGCGGTGCAATTGTTAATTCAATCATTCAGGTCTTGGTTGATAAGTTAGCTTCAACCGAAATGATGGATTATTTTCGAACTAAACTCGATGGGAATTTGCTGATGAAATTAAACAATAGTTTGATTTCCATCAATGCTGTTGTTGAATATGCTGAGCAGCAGCAGATCAGAAGATCTACTGTGAGGACATGGATTTGTAATGTCAAAGATGCTATAATGGATGCTGAGGATGTTCTTGATGAAATCTACATACAGAATTTGAAGTCCAAGCTTCCTTTTACTTCTTATCACAAGAATGTTCAATCCAAATTACAAGATATTGCTGCAAACCTAGAACTTCTAGTGAACATGAAGAATACCCTTTCGTTGAATGATAAAACTGCTGCTGATGGTTCTACTCTCTGCTCACCGATCATTCCAACTAATCTACCTCGTGAGCCTTTTATTTATGGCAGGGATAATGAGAAAGAACTTATTTCTGATTGGCTAAAATTTAAAAATGATAAGCTCTCTGTAATTTCCCTCGTTGCTATGGGGGGTATGGGTAAAACTACTCTTGCGCAACATTTGTTTAATGATCCTAGCATCCAGGAAAATTTTGATGTTTTAGCTTGGGTACATGTTTCTGGTGAATTTAATGCTCTTCAAATAATGAGGGACACTCTTGCAGAAATCAGTGGTTCATACCTTAATGATACTAATTTCACTCTGGTTCAACGTAAGGTAGCAAATGAACTGAATGGGAAGAAGTTTTTTATTGTTTTGGACAATATGTGGAATGACAACGAAGTGGAATTGAAAGATTTGAAGATTCCATTTCAGTGTGGGGCTGAGGGAAGTAAAATCCTTGTCACTACGCGCAAAAGTGAAGTTGCTTCAGGCATGGAGTCAGATCATACTCATCTTCTACAAAAATTAGAAGAAGAACATGCATGGGACTTGTTTTCCAAACATGCATTCAAAAATCTAGAGAGTTCTCGAATAACCATTGGCCCAGGAGTTTTTGAGTTAATTGCCGAAGATGTCATGAGGAAATGTAACGGATTACCTTTAGCTTTGGAAGCAATTGGGCGTCTCTTGAGCGTACATTCATCCTTCAAGGACTGGAGTGAGATATCGAAAAGCGGTATATGGAACTTACCAGGAGAAACACGAATTGTCCCTGCTTTGATGTTAAGTTATCAAAAGCTTCCATATGATCTTAAGAGATGTTTTGGGTACTGTGCATTATTCCCTAAAGGCTACCTATTTGACAAGGATGATTTAATTTTACTATGGACGGCTGAAAACTTTCTCCCTGGACAAAAGAAGGGTGAAAACTTTCTCCCTGGACAAAAGAAGGGTGAGTCGTACTTTAACCATCTACTGTCAATATCATTTTTCCAACCATCAGAAAAATATAAAAATTATTTTATCATGCATGATTTATTTCATGACTTAGCTGAAACTGTGTTTGGGGATTTTTGCTTAACATTGGGAGCCGAAAGAGGGAAAAATATATCAGGGATAACTCGTCATTTTTCATTTGTATGTGATAAAATTGGATCTTCAAAAGGGTTCGAGACCTTATATACAGATAATAAGTTGTGGACATTTATACCACTGTCTATGAATTCTTACCAACATCGTTGGTTGTCGCCCTTGACGTCATTGGAGCTTCCAAAGTTGTTCTTGAAATGTAAGTTGTTGCGTGTATTGTCATTGTGCGGATACATGGATATGGTGGAGTTGCCGGATACAGTAAGAAATCTTATACACCTCCGTCATCTCGACCTTTCCCGGACTGGGATAAGAAATTTGCCGGATTCTTTATGCTCCCTCCTTTACTTGCAAACATTGAAGGTGAAGGATTGTGAGTATTTGGAAGAGCTGCCTGTGAATTTACACAAACTGGTGAAATTGTCTTATCTTGACTTTAGTGGAACTAAGGTTACAAGAATGCCAATCCAAATGGATAGACTACAAAATCTTCAAGTTCTTAGTTCCTTTTATGTGGACAAGGGCAGTGAGTCCAATGTGAAACAGTTAGGAGATCTCACTCTACATGGAGATCTGTCCATTTTCGAGCTACAGAATATTACTAATCCATCAGATGCAGCTCTGGCAGATATGAAAAGTAAATCTCATCTTTTGAAACTAAATTTAAGGTGGAACGCTACTAGTACCAGTTCAAAAAATGAAAGGGAGGTGCTCGAGAACCTTAAACCTTCCATACATTTGACAACGCTCTCAATTGAAAAGTACGGTGGAACATTTTTTCCAAGTTGGTTTGGAGACAACTCATTGATAAGTCTGGTATCGCTAGAGTTGAGCAATTGTAAACATTGTATGATGCTTCCTTCGCTTGGAACTATGTCATCACTTAAGCACCTTCGGATCACTGGGCTCTCTGGGATAGTGGAGATTAGGACGGAGTTTTATAGGGATGTGAGCTGCTCTTCTCCATCTGTTCCATTTCCATCCTTGGAAACTTTAATTTTTAAGGATATGGATGGATGGAAAGATTGGGAATCTGAAGCTGTTGAGGTTGAGGGTGTATTTCCACGCCTACGAAAGCTTTATATAGTGCGATGTCCAAGTCTGAAAGGCAAAATGCCAAAGTCACTTGAATGTTTAGTGAATTTGAAAATCTGTGACTGTAAACAACTTGTTGATTCTGTTCCATCTTCTCCGAAAATCAGTGAATTACGTCTAATCAATTGCGGAGAATTGGAATTTAATTATTGTTCACCCTCTCTGAAGTTTCTTGAGATCCGTGGATGTTGCTTGGGAGGATCCTCCGTGCATTTGATCGGGAGTGCCTTATCTGAATGTGGTACCAACATTAAAGTGTTGAAAATTGAAGACTGTCCAACTGTGCAAATTCCACTAGCTGGTCACTACAATTTCCTTGTAAAATTGGTCATCAGTGGTGGCTGTGACTCTCTAACGACCTTCCCTCTCAAACTGTTCCCGAATCTTGACACTCTTGATGTTTATAAGTGTATTAATTTCGAAATGATTTCACAGGAAAATGAACATCTTAAACTCACATCTCTCTTAATTGAAGAGTGTCCTAAATTTGCATCATTTCCAAATGGAGGATTGTCTGCACCCAGGCTTCAGCAGTTTTATCTTTCAAAATTAGAGGAGTTAAAATCACTTCCTGAATGCATGCATATCCTCCTTCCATCTCTCTATAAGCTGTCTATAAATGATTGTCCACAATTGGTGTCCTTCTCCGCTAGAGGTTTGCCTTCAAGTATAAAAAGCCTCCTTCTCATTAAATGTTCCAACCTTCTCATCAACTCCCTGAAATGGGCGTTTCCAGCAAATACATCTCTCTGTTACATGTATATCCAAGAAACAGATGTGGAGTCTTTTCCCAATCAAGGGTTGATTCCACTCTCTCTTACCACTCTAAATATCACTGGTTGTCAAAATCTCAAACAACTTGACTACAAGGGTCTCGACCACCTCCCCTCTCTTTCATCATTAACTCTTAAAAACTGTCCCAACATAAAACGTTTACCGAAGGAGGGTCTACCTAGATCCATATCAACTTTACAGATTTCGGGGAACTGTCCATTCCTTTTAGAAAGATGCAAGAAACCTTATGGAAAGGATTGCGAGAGGATTGCGCATATTCAATGTATAATGATTGACGATCCTGAGAGGGACCAACAGTCATAG


Protein sequences

Name Description Sequence
Disease resistance protein Disease resistance protein [Medicago truncatula].

MAAEFVGGAIVNSIIQVLVDKLASTEMMDYFRTKLDGNLLMKLNNSLISINAVVEYAEQQQIRRSTVRTWICNVKDAIMDAEDVLDEIYIQNLKSKLPFTSYHKNVQSKLQDIAANLELLVNMKNTLSLNDKTAADGSTLCSPIIPTNLPREPFIYGRDNEKELISDWLKFKNDKLSVISLVAMGGMGKTTLAQHLFNDPSIQENFDVLAWVHVSGEFNALQIMRDTLAEISGSYLNDTNFTLVQRKVANELNGKKFFIVLDNMWNDNEVELKDLKIPFQCGAEGSKILVTTRKSEVASGMESDHTHLLQKLEEEHAWDLFSKHAFKNLESSRITIGPGVFELIAEDVMRKCNGLPLALEAIGRLLSVHSSFKDWSEISKSGIWNLPGETRIVPALMLSYQKLPYDLKRCFGYCALFPKGYLFDKDDLILLWTAENFLPGQKKGENFLPGQKKGESYFNHLLSISFFQPSEKYKNYFIMHDLFHDLAETVFGDFCLTLGAERGKNISGITRHFSFVCDKIGSSKGFETLYTDNKLWTFIPLSMNSYQHRWLSPLTSLELPKLFLKCKLLRVLSLCGYMDMVELPDTVRNLIHLRHLDLSRTGIRNLPDSLCSLLYLQTLKVKDCEYLEELPVNLHKLVKLSYLDFSGTKVTRMPIQMDRLQNLQVLSSFYVDKGSESNVKQLGDLTLHGDLSIFELQNITNPSDAALADMKSKSHLLKLNLRWNATSTSSKNEREVLENLKPSIHLTTLSIEKYGGTFFPSWFGDNSLISLVSLELSNCKHCMMLPSLGTMSSLKHLRITGLSGIVEIRTEFYRDVSCSSPSVPFPSLETLIFKDMDGWKDWESEAVEVEGVFPRLRKLYIVRCPSLKGKMPKSLECLVNLKICDCKQLVDSVPSSPKISELRLINCGELEFNYCSPSLKFLEIRGCCLGGSSVHLIGSALSECGTNIKVLKIEDCPTVQIPLAGHYNFLVKLVISGGCDSLTTFPLKLFPNLDTLDVYKCINFEMISQENEHLKLTSLLIEECPKFASFPNGGLSAPRLQQFYLSKLEELKSLPECMHILLPSLYKLSINDCPQLVSFSARGLPSSIKSLLLIKCSNLLINSLKWAFPANTSLCYMYIQETDVESFPNQGLIPLSLTTLNITGCQNLKQLDYKGLDHLPSLSSLTLKNCPNIKRLPKEGLPRSISTLQISGNCPFLLERCKKPYGKDCERIAHIQCIMIDDPERDQQS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
9-894 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AIVNSIIQVLVDKLASTEMMDYFRTKLDGNLLMKLNNSLISINAVVEYAEQQQIRRSTVRTWICNVKDAIMDAEDVLDEIYIQNLKSKLPFTSYHKNVQSKLQDIAANLELLVNMKNTLSLNDKTAADGSTLCSPIIPTNLPREPFIYGRDNEKELISDWLKFKNDKLSVISLVAMGGMGKTTLAQHLFNDPSIQENFDVLAWVHVSGEFNALQIMRDTLAEISGSYLNDTNFTLVQRKVANELNGKKFFIVLDNMWNDNEVELKDLKIPFQCGAEGSKILVTTRKSEVASGMESDHTHLLQKLEEEHAWDLFSKHAFKNLESSRITIGPGVFELIAEDVMRKCNGLPLALEAIGRLLSVHSSFKDWSEISKSGIWNLPGETRIVPALMLSYQKLPYDLKRCFGYCALFPKGYLFDKDDLILLWTAENFLPGQKKGENFLPGQKKGESYFNHLLSISFFQPSEKYKNYFIMHDLFHDLAETVFGDFCLTLGAERGKNISGITRHFSFVCDKIGSSKGFETLYTDNKLWTFIPLSMNSYQHRWLSPLTSLELPKLFLKCKLLRVLSLCGYMDMVELPDTVRNLIHLRHLDLSRTGIRNLPDSLCSLLYLQTLKVKDCEYLEELPVNLHKLVKLSYLDFSGTKVTRMPIQMDRLQNLQVLSSFYVDKGSESNVKQLGDLTLHGDLSIFELQNITNPSDAALADMKSKSHLLKLNLRWNATSTSSKNEREVLENLKPSIHLTTLSIEKYGGTFFPSWFGDNSLISLVSLELSNCKHCMMLPSLGTMSSLKHLRITGLSGIVEIRTEFYRDVSCSSPSVPFPSLETLIFKDMDGWKDWESEAVEVEGVFPRLRKLYIVRCPSLKGKMPKSLECLVNLKICDCKQLVDSVP

HMMPanther: PTHR23155:SF236
9-894 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

AIVNSIIQVLVDKLASTEMMDYFRTKLDGNLLMKLNNSLISINAVVEYAEQQQIRRSTVRTWICNVKDAIMDAEDVLDEIYIQNLKSKLPFTSYHKNVQSKLQDIAANLELLVNMKNTLSLNDKTAADGSTLCSPIIPTNLPREPFIYGRDNEKELISDWLKFKNDKLSVISLVAMGGMGKTTLAQHLFNDPSIQENFDVLAWVHVSGEFNALQIMRDTLAEISGSYLNDTNFTLVQRKVANELNGKKFFIVLDNMWNDNEVELKDLKIPFQCGAEGSKILVTTRKSEVASGMESDHTHLLQKLEEEHAWDLFSKHAFKNLESSRITIGPGVFELIAEDVMRKCNGLPLALEAIGRLLSVHSSFKDWSEISKSGIWNLPGETRIVPALMLSYQKLPYDLKRCFGYCALFPKGYLFDKDDLILLWTAENFLPGQKKGENFLPGQKKGESYFNHLLSISFFQPSEKYKNYFIMHDLFHDLAETVFGDFCLTLGAERGKNISGITRHFSFVCDKIGSSKGFETLYTDNKLWTFIPLSMNSYQHRWLSPLTSLELPKLFLKCKLLRVLSLCGYMDMVELPDTVRNLIHLRHLDLSRTGIRNLPDSLCSLLYLQTLKVKDCEYLEELPVNLHKLVKLSYLDFSGTKVTRMPIQMDRLQNLQVLSSFYVDKGSESNVKQLGDLTLHGDLSIFELQNITNPSDAALADMKSKSHLLKLNLRWNATSTSSKNEREVLENLKPSIHLTTLSIEKYGGTFFPSWFGDNSLISLVSLELSNCKHCMMLPSLGTMSSLKHLRITGLSGIVEIRTEFYRDVSCSSPSVPFPSLETLIFKDMDGWKDWESEAVEVEGVFPRLRKLYIVRCPSLKGKMPKSLECLVNLKICDCKQLVDSVP

superfamily: SSF52540
138-390 SSF52540

STLCSPIIPTNLPREPFIYGRDNEKELISDWLKFKNDKLSVISLVAMGGMGKTTLAQHLFNDPSIQENFDVLAWVHVSGEFNALQIMRDTLAEISGSYLNDTNFTLVQRKVANELNGKKFFIVLDNMWNDNEVELKDLKIPFQCGAEGSKILVTTRKSEVASGMESDHTHLLQKLEEEHAWDLFSKHAFKNLESSRITIGPGVFELIAEDVMRKCNGLPLALEAIGRLLSVHSSFKDWSEISKSGIWNLPGET

HMMPfam: PF00931
IPR002182
159-439 NB-ARC,NBS
NB-ARC

DNEKELISDWLKFKNDKLSVISLVAMGGMGKTTLAQHLFNDPSIQENFDVLAWVHVSGEFNALQIMRDTLAEISGSYLNDTNFTLVQRKVANELNGKKFFIVLDNMWNDNEVELKDLKIPFQCGAEGSKILVTTRKSEVASGMESDHTHLLQKLEEEHAWDLFSKHAFKNLESSRITIGPGVFELIAEDVMRKCNGLPLALEAIGRLLSVHSSFKDWSEISKSGIWNLPGETRIVPALMLSYQKLPYDLKRCFGYCALFPKGYLFDKDDLILLWTAENFLP

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

VISLVAMGGMGKTTLA

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

ELNGKKFFIVLDNMW

FPrintScan: PR00364
IPR000767
352-366 DISEASERSIST
Disease resistance protein

CNGLPLALEAIGRLL

superfamily: SSF52058
478-883 SSF52058,LRR

IMHDLFHDLAETVFGDFCLTLGAERGKNISGITRHFSFVCDKIGSSKGFETLYTDNKLWTFIPLSMNSYQHRWLSPLTSLELPKLFLKCKLLRVLSLCGYMDMVELPDTVRNLIHLRHLDLSRTGIRNLPDSLCSLLYLQTLKVKDCEYLEELPVNLHKLVKLSYLDFSGTKVTRMPIQMDRLQNLQVLSSFYVDKGSESNVKQLGDLTLHGDLSIFELQNITNPSDAALADMKSKSHLLKLNLRWNATSTSSKNEREVLENLKPSIHLTTLSIEKYGGTFFPSWFGDNSLISLVSLELSNCKHCMMLPSLGTMSSLKHLRITGLSGIVEIRTEFYRDVSCSSPSVPFPSLETLIFKDMDGWKDWESEAVEVEGVFPRLRKLYIVRCPSLKGKMPKSLECLVNLKI

Gene3D: G3DSA:3.80.10.10
523-745 G3DSA:3.80.10.10

SKGFETLYTDNKLWTFIPLSMNSYQHRWLSPLTSLELPKLFLKCKLLRVLSLCGYMDMVELPDTVRNLIHLRHLDLSRTGIRNLPDSLCSLLYLQTLKVKDCEYLEELPVNLHKLVKLSYLDFSGTKVTRMPIQMDRLQNLQVLSSFYVDKGSESNVKQLGDLTLHGDLSIFELQNITNPSDAALADMKSKSHLLKLNLRWNATSTSSKNEREVLENLKPSIH

Gene3D: G3DSA:3.80.10.10
746-805 G3DSA:3.80.10.10

LTTLSIEKYGGTFFPSWFGDNSLISLVSLELSNCKHCMMLPSLGTMSSLKHLRITGLSGI

FPrintScan: PR00364
IPR000767
766-782 DISEASERSIST
Disease resistance protein

NSLISLVSLELSNCKHC

Gene3D: G3DSA:3.80.10.10
841-958 G3DSA:3.80.10.10

DWESEAVEVEGVFPRLRKLYIVRCPSLKGKMPKSLECLVNLKICDCKQLVDSVPSSPKISELRLINCGELEFNYCSPSLKFLEIRGCCLGGSSVHLIGSALSECGTNIKVLKIEDCPT

superfamily: SSF52058
946-1214 SSF52058,LRR

TNIKVLKIEDCPTVQIPLAGHYNFLVKLVISGGCDSLTTFPLKLFPNLDTLDVYKCINFEMISQENEHLKLTSLLIEECPKFASFPNGGLSAPRLQQFYLSKLEELKSLPECMHILLPSLYKLSINDCPQLVSFSARGLPSSIKSLLLIKCSNLLINSLKWAFPANTSLCYMYIQETDVESFPNQGLIPLSLTTLNITGCQNLKQLDYKGLDHLPSLSSLTLKNCPNIKRLPKEGLPRSISTLQISGNCPFLLERCKKPYGKDCERIAH

Gene3D: G3DSA:3.80.10.10
987-1098 G3DSA:3.80.10.10

LKLFPNLDTLDVYKCINFEMISQENEHLKLTSLLIEECPKFASFPNGGLSAPRLQQFYLSKLEELKSLPECMHILLPSLYKLSINDCPQLVSFSARGLPSSIKSLLLIKCSN

Gene3D: G3DSA:3.80.10.10
1137-1193 G3DSA:3.80.10.10

LTTLNITGCQNLKQLDYKGLDHLPSLSSLTLKNCPNIKRLPKEGLPRSISTLQISGN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox