PRGDB00044662 (Disease resistance protein; Aminoacyl-tRNA synthetase, class 1a, anticodon-binding)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein; Aminoacyl-tRNA synthetase, class 1a, anticodon-binding
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 62910037 (AC158497)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula chromosome 2 clone mth2-48e18, complete sequence.

DNA Sequence

ATGGCAGTGGCGGCTGTAGGTGAAGCATTTCTGTCTGCTTTCATTGAAGTTGTCCTCGACAGGCTCGCTTCTCCTGAGGTTGTTGTCTTGATCCGTGGGAAGAAAGTTGACGTCAATTTGGTCCAAAGGTTGAAGAACACTCTTTATGCTGTGGAAGCTGTGTTTAACGATGCGGAGCAAAAACAGTTCAAAAACCCTGCTATTAACAGATGGATCGATGATCTCAAAGGTGTTGTCTATGTAGCTGATGACCTTCTTGACAACATTTCAACCAAAGCTGCTACACAGAAAAACAAGCAGGTGAGTACTGCTAATTATTTATCTCGCTTTTTCAACTTTGAAGAAAGGGACATGCTTTGTAAGCTGGAAAATATAGTTGCTAAACTTGAATCCATTCTCAAATTCAAAGATATTCTTGGTCTTCAACATATTGCAATCGAACACCACTCTTCTTGGAGAACTTCATCAACCTCTCTAGATGACCCATCTAACATATTTGGTAGGGATGCAGACAAAAAGGCCATACTCAAATTACTGTTAGATGATGATGATTGCTGTAAGACTTGCGTGATCCCCATAGTTGGTATGGGTGGTGTGGGAAAAACAATTTTAGCCCAATCTGTGTACAACCATGACAGTATAAAGCAGAAGTTTGATGTTCAAGCATGGGCTTGTGCCTCGGATCATTTCGATGAATTTAATGTTACAAAGGCCATATTGGAGTCTGTTACAGGGAATGCTTGTAGCATAAACAGCAACGAGTTGCTTCATCGTGATTTGAAGGAAAAACTGACTGGAAAAAAGTTCTTAATTGTTTTGGATGATGTATGGACCGAGGATTATGACAGCTGGAATTCTCTTTTAAGGCCTCTTCAATACGGGGCTAAGGGAAATAAAATTCTTGTAACAACTCGTATTGAAAAAGTTGCTTCTATGGTCCAAACTTTTCAAGGTTAA


Protein sequences

Name Description Sequence
Disease resistance protein; Aminoacyl-tRNA synthetase, class 1a, anticodon-binding Disease resistance protein; Aminoacyl-tRNA synthetase, class 1a, anticodon-binding [Medicago truncatula].

MAVAAVGEAFLSAFIEVVLDRLASPEVVVLIRGKKVDVNLVQRLKNTLYAVEAVFNDAEQKQFKNPAINRWIDDLKGVVYVADDLLDNISTKAATQKNKQVSTANYLSRFFNFEERDMLCKLENIVAKLESILKFKDILGLQHIAIEHHSSWRTSSTSLDDPSNIFGRDADKKAILKLLLDDDDCCKTCVIPIVGMGGVGKTILAQSVYNHDSIKQKFDVQAWACASDHFDEFNVTKAILESVTGNACSINSNELLHRDLKEKLTGKKFLIVLDDVWTEDYDSWNSLLRPLQYGAKGNKILVTTRIEKVASMVQTFQG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
9-306 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

AFLSAFIEVVLDRLASPEVVVLIRGKKVDVNLVQRLKNTLYAVEAVFNDAEQKQFKNPAINRWIDDLKGVVYVADDLLDNISTKAATQKNKQVSTANYLSRFFNFEERDMLCKLENIVAKLESILKFKDILGLQHIAIEHHSSWRTSSTSLDDPSNIFGRDADKKAILKLLLDDDDCCKTCVIPIVGMGGVGKTILAQSVYNHDSIKQKFDVQAWACASDHFDEFNVTKAILESVTGNACSINSNELLHRDLKEKLTGKKFLIVLDDVWTEDYDSWNSLLRPLQYGAKGNKILVTTRI

HMMPanther: PTHR23155
9-306 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AFLSAFIEVVLDRLASPEVVVLIRGKKVDVNLVQRLKNTLYAVEAVFNDAEQKQFKNPAINRWIDDLKGVVYVADDLLDNISTKAATQKNKQVSTANYLSRFFNFEERDMLCKLENIVAKLESILKFKDILGLQHIAIEHHSSWRTSSTSLDDPSNIFGRDADKKAILKLLLDDDDCCKTCVIPIVGMGGVGKTILAQSVYNHDSIKQKFDVQAWACASDHFDEFNVTKAILESVTGNACSINSNELLHRDLKEKLTGKKFLIVLDDVWTEDYDSWNSLLRPLQYGAKGNKILVTTRI

superfamily: SSF52540
148-313 SSF52540

HHSSWRTSSTSLDDPSNIFGRDADKKAILKLLLDDDDCCKTCVIPIVGMGGVGKTILAQSVYNHDSIKQKFDVQAWACASDHFDEFNVTKAILESVTGNACSINSNELLHRDLKEKLTGKKFLIVLDDVWTEDYDSWNSLLRPLQYGAKGNKILVTTRIEKVASMV

Gene3D: G3DSA:3.40.50.300
167-305 G3DSA:3.40.50.300

GRDADKKAILKLLLDDDDCCKTCVIPIVGMGGVGKTILAQSVYNHDSIKQKFDVQAWACASDHFDEFNVTKAILESVTGNACSINSNELLHRDLKEKLTGKKFLIVLDDVWTEDYDSWNSLLRPLQYGAKGNKILVTTR

HMMPfam: PF00931
IPR002182
170-314 NB-ARC,NBS
NB-ARC

ADKKAILKLLLDDDDCCKTCVIPIVGMGGVGKTILAQSVYNHDSIKQKFDVQAWACASDHFDEFNVTKAILESVTGNACSINSNELLHRDLKEKLTGKKFLIVLDDVWTEDYDSWNSLLRPLQYGAKGNKILVTTRIEKVASMVQ

FPrintScan: PR00364
IPR000767
190-205 DISEASERSIST
Disease resistance protein

VIPIVGMGGVGKTILA

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

KLTGKKFLIVLDDVW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox