PRGDB00044663 (Disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 62910037 (AC158497)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula chromosome 2 clone mth2-48e18, complete sequence.

DNA Sequence

ATGGCTGTTGTTGGTGAAGCTTTTCTGTCTGCTTTCCTTGAAGCTTTTGATGACCTCAAAGATGCTCCCTATATAGCTGACGACCTTCTCGATCATATCTCTACTAAAGTTTCTATTTCCAAGAACAAGGAGAAGCATATATATATAGTTGCTAGGCTTGAATACATTCTCAAATTCAAAGATATTCTTAGTCTTCAACATGTTGCAACTGATCACCACTCTTCTTGGAGAACTCCATCCACCTCTCTAGATGCCGGCGAATCTAACTTATTTGGTAGGGATCAAGACAAAATTGCCATAGACGATGATCATGTTGATGATAAGACTTGTATGACTGTGATCCCCATAGTTGGCATGGGTGGTGTGGGAAAAATCACTTTAGCCCAATCTGTATACAATCATGCAGCTATATTGGAGTCAGTTACACAGAGTTCTTGTAACATAAATAACAAAGAGTTACTTCATTGTGATTTGAAGGAAAAACTGACTGGAAAAAAGTTCTTGATTGTTTTGGACGATGTTTGGATCAAGGATTATAACAGTTGGAATTCTCTTATGATGCCTCTTCAATACGGAGCTAAGGGAAGCAAAATTCTTGTAACAACGCGTAGTGATAAAGTTGCTTCTATGGTCCAAACTTTTCAAGGTTATTCTCTTGAGAAATTGTCTGATGAAGATTGTTGGTCAGTGTTTGCAATCCATGCATGCCTTTCACCCGAACAATCCACCGAGAAGACGGATCTCCAAAAAACTGGTAGAGAGATTGTTAGAAAATGTAAGGGATTGCCATTAGCAGCAAAATCACTTGGAGGCCTTTTGCGAAGTACACATGACATCAGTGATTGGAATAATCTACTACATAGTAACATTTGGGAAACTCAGAGTAAGATCATTCCAGCATTGAGAATTAGTTATCAACATCTACCCCCTTATTTGAAACGCTGCTTTGTTTACTGTTCATTGTTTCCTAAGGATCATGAATTTTACAGAGAGGAACTGATCTTGTTGTGGATGGCAGAAGATCTTTTACAGCCTCCAAAAACTGGTAAGACTTTAGAAGCAGTTGGTAATGATCATTTTAATGATTTAGTTTCCATATCATTTTTTCAACGTTCCTGGAGTGGGAGCCTGTGTTTTGTGATGCATGATCTGGTGCATGATTTAGCAACATTTACTAGTGGAGAATTCTATTTCCAATCAGAAGATCTTGGGAGAGAAACGGAGATTATTGGTGCCAAGACTCGTCATTTGTCATTTGCCGAGTTCACCGACCCAGCCTTAGAAAACTTTGAATTTTTTGGCAGACCTATATTTCTGAGGACATTTTTCCCAATCATTTATAATGATTATTTCTACAATGAAAATATAGCACATATCATTTTGTTGAATTTGAAATACTTGAGAGTTTTGTCATTTAACTGCTTTACACTTCTCCATACATTGCCGGATTCAATAGGTGAATTGATCCATTTGCGTTATTTGGATCTCTCTAGCTCAGGTGTAGAGACTTTACCAGACTCGTTGTGTAACCTGTATAATCTACAAACTTTGAAACTGTGCTATTGTGAACAGCTGACCAAGCTACCCAGGGACATGCAAAATCTTGTAAATTTGCGCCATTTTGATTTCAAGGAAACTTATTTAGAAGAGATGCCTAGAGAAATGAGCCGATTAAATCATTTGCAACATCTAAGTTATTTTGTTGTGGGCAAGCATGAAGACAAAGGGATCAAGGAATTGGGTACACTTTGA


Protein sequences

Name Description Sequence
Disease resistance protein Disease resistance protein [Medicago truncatula].

MAVVGEAFLSAFLEAFDDLKDAPYIADDLLDHISTKVSISKNKEKHIYIVARLEYILKFKDILSLQHVATDHHSSWRTPSTSLDAGESNLFGRDQDKIAIDDDHVDDKTCMTVIPIVGMGGVGKITLAQSVYNHAAILESVTQSSCNINNKELLHCDLKEKLTGKKFLIVLDDVWIKDYNSWNSLMMPLQYGAKGSKILVTTRSDKVASMVQTFQGYSLEKLSDEDCWSVFAIHACLSPEQSTEKTDLQKTGREIVRKCKGLPLAAKSLGGLLRSTHDISDWNNLLHSNIWETQSKIIPALRISYQHLPPYLKRCFVYCSLFPKDHEFYREELILLWMAEDLLQPPKTGKTLEAVGNDHFNDLVSISFFQRSWSGSLCFVMHDLVHDLATFTSGEFYFQSEDLGRETEIIGAKTRHLSFAEFTDPALENFEFFGRPIFLRTFFPIIYNDYFYNENIAHIILLNLKYLRVLSFNCFTLLHTLPDSIGELIHLRYLDLSSSGVETLPDSLCNLYNLQTLKLCYCEQLTKLPRDMQNLVNLRHFDFKETYLEEMPREMSRLNHLQHLSYFVVGKHEDKGIKELGTL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF28
1-540 PTHR11017:SF28

MAVVGEAFLSAFLEAFDDLKDAPYIADDLLDHISTKVSISKNKEKHIYIVARLEYILKFKDILSLQHVATDHHSSWRTPSTSLDAGESNLFGRDQDKIAIDDDHVDDKTCMTVIPIVGMGGVGKITLAQSVYNHAAILESVTQSSCNINNKELLHCDLKEKLTGKKFLIVLDDVWIKDYNSWNSLMMPLQYGAKGSKILVTTRSDKVASMVQTFQGYSLEKLSDEDCWSVFAIHACLSPEQSTEKTDLQKTGREIVRKCKGLPLAAKSLGGLLRSTHDISDWNNLLHSNIWETQSKIIPALRISYQHLPPYLKRCFVYCSLFPKDHEFYREELILLWMAEDLLQPPKTGKTLEAVGNDHFNDLVSISFFQRSWSGSLCFVMHDLVHDLATFTSGEFYFQSEDLGRETEIIGAKTRHLSFAEFTDPALENFEFFGRPIFLRTFFPIIYNDYFYNENIAHIILLNLKYLRVLSFNCFTLLHTLPDSIGELIHLRYLDLSSSGVETLPDSLCNLYNLQTLKLCYCEQLTKLPRDMQNLVNLRH

HMMPanther: PTHR11017
1-540 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAVVGEAFLSAFLEAFDDLKDAPYIADDLLDHISTKVSISKNKEKHIYIVARLEYILKFKDILSLQHVATDHHSSWRTPSTSLDAGESNLFGRDQDKIAIDDDHVDDKTCMTVIPIVGMGGVGKITLAQSVYNHAAILESVTQSSCNINNKELLHCDLKEKLTGKKFLIVLDDVWIKDYNSWNSLMMPLQYGAKGSKILVTTRSDKVASMVQTFQGYSLEKLSDEDCWSVFAIHACLSPEQSTEKTDLQKTGREIVRKCKGLPLAAKSLGGLLRSTHDISDWNNLLHSNIWETQSKIIPALRISYQHLPPYLKRCFVYCSLFPKDHEFYREELILLWMAEDLLQPPKTGKTLEAVGNDHFNDLVSISFFQRSWSGSLCFVMHDLVHDLATFTSGEFYFQSEDLGRETEIIGAKTRHLSFAEFTDPALENFEFFGRPIFLRTFFPIIYNDYFYNENIAHIILLNLKYLRVLSFNCFTLLHTLPDSIGELIHLRYLDLSSSGVETLPDSLCNLYNLQTLKLCYCEQLTKLPRDMQNLVNLRH

superfamily: SSF52540
73-297 SSF52540

HSSWRTPSTSLDAGESNLFGRDQDKIAIDDDHVDDKTCMTVIPIVGMGGVGKITLAQSVYNHAAILESVTQSSCNINNKELLHCDLKEKLTGKKFLIVLDDVWIKDYNSWNSLMMPLQYGAKGSKILVTTRSDKVASMVQTFQGYSLEKLSDEDCWSVFAIHACLSPEQSTEKTDLQKTGREIVRKCKGLPLAAKSLGGLLRSTHDISDWNNLLHSNIWETQSKI

HMMPfam: PF00931
IPR002182
109-137 NB-ARC,NBS
NB-ARC

TCMTVIPIVGMGGVGKITLAQSVYNHAAI

FPrintScan: PR00364
IPR000767
113-128 DISEASERSIST
Disease resistance protein

VIPIVGMGGVGKITLA

Gene3D: G3DSA:3.80.10.10
131-158 G3DSA:3.80.10.10

VYNHAAILESVTQSSCNINNKELLHCDL

HMMPfam: PF00931
IPR002182
141-345 NB-ARC,NBS
NB-ARC

VTQSSCNINNKELLHCDLKEKLTGKKFLIVLDDVWIKDYNSWNSLMMPLQYGAKGSKILVTTRSDKVASMVQTFQGYSLEKLSDEDCWSVFAIHACLSPEQSTEKTDLQKTGREIVRKCKGLPLAAKSLGGLLRSTHDISDWNNLLHSNIWETQSKIIPALRISYQHLPPYLKRCFVYCSLFPKDHEFYREELILLWMAEDLLQP

FPrintScan: PR00364
IPR000767
259-273 DISEASERSIST
Disease resistance protein

CKGLPLAAKSLGGLL

superfamily: SSF52058
380-565 SSF52058,LRR

VMHDLVHDLATFTSGEFYFQSEDLGRETEIIGAKTRHLSFAEFTDPALENFEFFGRPIFLRTFFPIIYNDYFYNENIAHIILLNLKYLRVLSFNCFTLLHTLPDSIGELIHLRYLDLSSSGVETLPDSLCNLYNLQTLKLCYCEQLTKLPRDMQNLVNLRHFDFKETYLEEMPREMSRLNHLQHLS

Gene3D: G3DSA:3.80.10.10
461-565 G3DSA:3.80.10.10

LLNLKYLRVLSFNCFTLLHTLPDSIGELIHLRYLDLSSSGVETLPDSLCNLYNLQTLKLCYCEQLTKLPRDMQNLVNLRHFDFKETYLEEMPREMSRLNHLQHLS

FPrintScan: PR00364
IPR000767
509-525 DISEASERSIST
Disease resistance protein

CNLYNLQTLKLCYCEQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox