PRGDB00044664 (Disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 59858724 (AC157473)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula chromosome 7 clone mte1-11e4, complete sequence.

DNA Sequence

ATGGCAGAATCATTTCTCTTTAGCCTTGCTGAATCATTTATCACCAAGGTTGCTTCTCGTGCTGTTGAAGAAGCTTCATTGGCACTCGGCGTCTATGATGATCTACGAGAGATTAAAAACACTGTGTCACTCATCAAAGCAGTGCTCTTGGATGCTGAGTTAAAGCAGAAGCAGAATCACGAGCTTCGTGAATGGCTGCAACAGATCAAACGTGTCTTCTACGATGCAGAAGATGTAATCAATGATTTTGAGTGCGAGGCATTGCGAAAGCACGTAGTCAACACTTCTGGTAGCATCAGAAGGAAGGTACGACGTTACTTATCCAGTTCTAATCCTCTTGTTTATCGCCTTAAAATGGCACATCAAATCAAACATATTAATAAGAGATTGAATAAGAACGCTGCTGCTAGGCATAATTTTGGCCTTCAAATCAATGATAGCGATAATCATGTTGTAAAAAGGCGGGAGTTGACTCATTCGCATGTAGTTGATTCTGATGTGATAGGAAGGGATTACGATAAGCAAAAAATTATTGATCTCTTATTGCAAGATAGTGGTCATAAAAGTCTCTCTGTTATTCCTATTGTTGGAATTGGAGGCTTGGGAAAGACTACACTTGCAAAGACGGTGTTCAATGATAAGAGTTTAGACGAGACTTTCCCATTAAAGATGTGGGTGTGTGTCTCCGATGATTTTGAACTTCAGCATCTGCTCATTAAAATCCTCAATTCAGCTAGCGTTAGTGATGCCACTCCTAACCTCATTCACGAAGAGAACATTAAAAACCTTGATGTGCAGCAGCTACAAACTCATTTGAGAAACACACTTGCTGGCAAAAAATTCTTGCTTGTCTTGGATGACGTGTGGAGCGAGGATCGTGTCAAATGGATAGAGGTGAAGAATCTATTACAAGTAGGAGATGAAGGAAGTAAAGTTTTAGTGACTACACGTAGTCACTCAATTGCTAAAATGATGTGCACAAACACATCTTACACTTTGCAAGGTCTTTCTAGAGAGGATTCCTTGTCTGTATTTGTCAAATGGGCATTTAAAGAGGGAGAAGAGAAAAAATATCCAAAATTGATAGAGATTGGGAAAGAAATTGTTCAAAAATGTGGAGGGCTTCCTTTGGCCCTAAGAACATTGGGGAGTTTATTGTTCTTAAAAGATGATATAGAAGAGTGGAAGTTTGTTAGGGACAATGAGATTTGGAATTTACCACAAAAAGAAGATGATATTTTGCCTGCTATCAAATTAAGTTTTGATCAATTACCATCTTATTTAAAACGATGTTTTGCCTGCTTCTCCCTCTTCGAAAAAGACTTCAAATTTGTTACTTATACTGTCACTGTGCTTTGGGAGGCTCTTGATTTTCTTCCATCACCAAACAAGGGTAAAACCTTGGAAGATGTCGGTAATCAATTTTTGCACGAGCTACAATCAAGATCTTTCCTTCAAGATTTCTATGTCTCTGGTAATGTTTGTGTATTTAAATTGCATGATTTAGTGCATGATCTTGCCCTATATGTTGCCAGAGATGAGTTTCAATTGCTGAAACTCCATAATGAAAATATAATTAAGAATGTTCTCCATTTGTCATTTACTACAAATGATTTACTTGGACAAACACCAATTCCCGCAGGACTGAGAACCATACTTTTTCCATTAGAAGCCAACAATGTAGCTTTTTTGAACAATTTGGCATCAAGGTGTAAATTCTTGCGAGTTTTGCGGTTAACTCATTCTACATATGAGAGTTTGCCCCGCTCAATTGGTAAATTAAAACATTTGAGATATCTCAATCTTAAGGGAAATAAAGAATTGAAGAGCCTCCCTGATTCAGTGTGCAAACTTCAGAATTTGCAAACTTTGATTCTTGAGGGATGCTTAAAGCTTGAAAAATTACCCAATGGGATAGGAAATTTGATCAGCCTTCGACAACTACATATAACCACAATGCAATCTAGTTTTCCAGACAAAGAGATTGCCAAATTGACTTATCTAGAGTTCTTATCTATCTGTTCTTGTGACAATTTGGAGTCATTGCTTGGAGAATTAGAACTACCTAATCTTAAATCGTTGAGTATTATTTATTGTGGGAATATAACATCTTTGCCACTCCAGCTTATTCCAAATGTGGATAGTTTGATGATTAGTAATTGCAATAAGTTGAAATTGTCTTTGGGCCATGAGAATGCAATTCCCAAGTTAAGGCTCAAGTTACTGTATATTGAATCCTTGCCAGAATTGTTGAGTTTTCCTCAATGGTTGCAAGGATGTGCGGACACATTACACAGCTTATTTATTGGTCACTGTGAAAATCTTGAGAAACTTCCTGAGTGGTCATCAACTTTCATTTGTCTAAATACACTTACAATTAGAAATTGCCCGAAACTACTTTCACTCCCTGATGATGTGCATTGCCTCCCAAACCTTGAATGCTTAGAAATGAAAGATTGTCCTGAATTATGTAAAAGATACCAGCCAAAGGTAGGACATGATTGGCCCAAGATTTCACACATCAAACGAGTTAACATTAAATCATCAGAACATGAAAATTAA


Protein sequences

Name Description Sequence
Disease resistance protein Disease resistance protein [Medicago truncatula].

MAESFLFSLAESFITKVASRAVEEASLALGVYDDLREIKNTVSLIKAVLLDAELKQKQNHELREWLQQIKRVFYDAEDVINDFECEALRKHVVNTSGSIRRKVRRYLSSSNPLVYRLKMAHQIKHINKRLNKNAAARHNFGLQINDSDNHVVKRRELTHSHVVDSDVIGRDYDKQKIIDLLLQDSGHKSLSVIPIVGIGGLGKTTLAKTVFNDKSLDETFPLKMWVCVSDDFELQHLLIKILNSASVSDATPNLIHEENIKNLDVQQLQTHLRNTLAGKKFLLVLDDVWSEDRVKWIEVKNLLQVGDEGSKVLVTTRSHSIAKMMCTNTSYTLQGLSREDSLSVFVKWAFKEGEEKKYPKLIEIGKEIVQKCGGLPLALRTLGSLLFLKDDIEEWKFVRDNEIWNLPQKEDDILPAIKLSFDQLPSYLKRCFACFSLFEKDFKFVTYTVTVLWEALDFLPSPNKGKTLEDVGNQFLHELQSRSFLQDFYVSGNVCVFKLHDLVHDLALYVARDEFQLLKLHNENIIKNVLHLSFTTNDLLGQTPIPAGLRTILFPLEANNVAFLNNLASRCKFLRVLRLTHSTYESLPRSIGKLKHLRYLNLKGNKELKSLPDSVCKLQNLQTLILEGCLKLEKLPNGIGNLISLRQLHITTMQSSFPDKEIAKLTYLEFLSICSCDNLESLLGELELPNLKSLSIIYCGNITSLPLQLIPNVDSLMISNCNKLKLSLGHENAIPKLRLKLLYIESLPELLSFPQWLQGCADTLHSLFIGHCENLEKLPEWSSTFICLNTLTIRNCPKLLSLPDDVHCLPNLECLEMKDCPELCKRYQPKVGHDWPKISHIKRVNIKSSEHEN

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
150-409 SSF52540

HVVKRRELTHSHVVDSDVIGRDYDKQKIIDLLLQDSGHKSLSVIPIVGIGGLGKTTLAKTVFNDKSLDETFPLKMWVCVSDDFELQHLLIKILNSASVSDATPNLIHEENIKNLDVQQLQTHLRNTLAGKKFLLVLDDVWSEDRVKWIEVKNLLQVGDEGSKVLVTTRSHSIAKMMCTNTSYTLQGLSREDSLSVFVKWAFKEGEEKKYPKLIEIGKEIVQKCGGLPLALRTLGSLLFLKDDIEEWKFVRDNEIWNLPQK

Gene3D: G3DSA:3.40.50.300
168-326 G3DSA:3.40.50.300

IGRDYDKQKIIDLLLQDSGHKSLSVIPIVGIGGLGKTTLAKTVFNDKSLDETFPLKMWVCVSDDFELQHLLIKILNSASVSDATPNLIHEENIKNLDVQQLQTHLRNTLAGKKFLLVLDDVWSEDRVKWIEVKNLLQVGDEGSKVLVTTRSHSIAKMMC

HMMPfam: PF00931
IPR002182
171-460 NB-ARC,NBS
NB-ARC

DYDKQKIIDLLLQDSGHKSLSVIPIVGIGGLGKTTLAKTVFNDKSLDETFPLKMWVCVSDDFELQHLLIKILNSASVSDATPNLIHEENIKNLDVQQLQTHLRNTLAGKKFLLVLDDVWSEDRVKWIEVKNLLQVGDEGSKVLVTTRSHSIAKMMCTNTSYTLQGLSREDSLSVFVKWAFKEGEEKKYPKLIEIGKEIVQKCGGLPLALRTLGSLLFLKDDIEEWKFVRDNEIWNLPQKEDDILPAIKLSFDQLPSYLKRCFACFSLFEKDFKFVTYTVTVLWEALDFLP

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VIPIVGIGGLGKTTLA

FPrintScan: PR00364
IPR000767
275-289 DISEASERSIST
Disease resistance protein

TLAGKKFLLVLDDVW

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

CGGLPLALRTLGSLL

superfamily: SSF52058
482-840 SSF52058,LRR

RSFLQDFYVSGNVCVFKLHDLVHDLALYVARDEFQLLKLHNENIIKNVLHLSFTTNDLLGQTPIPAGLRTILFPLEANNVAFLNNLASRCKFLRVLRLTHSTYESLPRSIGKLKHLRYLNLKGNKELKSLPDSVCKLQNLQTLILEGCLKLEKLPNGIGNLISLRQLHITTMQSSFPDKEIAKLTYLEFLSICSCDNLESLLGELELPNLKSLSIIYCGNITSLPLQLIPNVDSLMISNCNKLKLSLGHENAIPKLRLKLLYIESLPELLSFPQWLQGCADTLHSLFIGHCENLEKLPEWSSTFICLNTLTIRNCPKLLSLPDDVHCLPNLECLEMKDCPELCKRYQPKVGHDWPKISH

Gene3D: G3DSA:3.80.10.10
568-825 G3DSA:3.80.10.10

ASRCKFLRVLRLTHSTYESLPRSIGKLKHLRYLNLKGNKELKSLPDSVCKLQNLQTLILEGCLKLEKLPNGIGNLISLRQLHITTMQSSFPDKEIAKLTYLEFLSICSCDNLESLLGELELPNLKSLSIIYCGNITSLPLQLIPNVDSLMISNCNKLKLSLGHENAIPKLRLKLLYIESLPELLSFPQWLQGCADTLHSLFIGHCENLEKLPEWSSTFICLNTLTIRNCPKLLSLPDDVHCLPNLECLEMKDCPELCK

HMMPfam: PF13855
574-629 LRR_8,Leucine rich repeat

LRVLRLTHSTYESLPRSIGKLKHLRYLNLKGNKELKSLPDSVCKLQNLQTLILEGC

FPrintScan: PR00364
IPR000767
592-608 DISEASERSIST
Disease resistance protein

GKLKHLRYLNLKGNKEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox