PRGDB00044665 (Disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 60361022 (AC155891)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula chromosome 2 clone mth2-4g10, complete sequence.

DNA Sequence

ATGAAGCCACTTCGGTTGATCTGGAGCGAATCAGCCTGGATTGAAGACATTAACAAAGCTGTATTAAAAACGTTAAGATACAAGTACAAAAATGAACTTACATTTAATTTCAAAACCGATGAAAATTATAGTAAAATTCAATCTTCAATAAACTTTGATTCTAGCAAAGTTCAAATCATTGGAATTTGGGGTGCAAAAGGCATAGGTAAGACAGCCATTGTTGCTGCTATGTTTCAAAATTTCTCTTGCAAATATCAAGGTACCTGCTTCTTAGAAAAGGTGGCAGAAGAATCAAAAAGGAATGGAATCAATTTCACTTATAAAAAACTTGTTTCCACATTACTCGGGGAAGATGTTAATATCGACACGCCTATAGTAATGTCATCCATGGTCATTAGAAGACTCAAAGGAATGAAAGCTTTCATTGTACTAGATGATGTTCGTAGTCCAGAAACTCTGAAAACTTTGATTAGAGAGAGAGGTGGTTGGCTAGGAGCTGGTAGCATAGTCATTGTGACTACTAGGGATGAGGATGTGCTGAAAAGTGGAGGAATTAGCAACACTCATAAAGTCCGAAATTCCCTCCGGATTTCCTACTTGAATAAGTTTACCATTTCCTTACCTAAGCAGGGATTTTTGGAGCTTTCAAGAAAAGCAATTCATTATGTCAATTGCAACCCTATAGCTTTGAAAGTTTTGAGATCATTTCATCGACTTTACACAAGTGAAATCGACTGGAAATGTGCACTAGCAAAACTAAAGGAAATCTCCAATGCCAAAATAATGAGATGGACTTATAAATTTCAGATTTGGGGAACAGGACAAGTTTGGGCACTCTTTCAGGCTTACAGATCAATGAAGGTCATGTTTGGACATTCTGTGAGGCTTATAGAGAAATGA


Protein sequences

Name Description Sequence
Disease resistance protein Disease resistance protein [Medicago truncatula].

MKPLRLIWSESAWIEDINKAVLKTLRYKYKNELTFNFKTDENYSKIQSSINFDSSKVQIIGIWGAKGIGKTAIVAAMFQNFSCKYQGTCFLEKVAEESKRNGINFTYKKLVSTLLGEDVNIDTPIVMSSMVIRRLKGMKAFIVLDDVRSPETLKTLIRERGGWLGAGSIVIVTTRDEDVLKSGGISNTHKVRNSLRISYLNKFTISLPKQGFLELSRKAIHYVNCNPIALKVLRSFHRLYTSEIDWKCALAKLKEISNAKIMRWTYKFQIWGTGQVWALFQAYRSMKVMFGHSVRLIEK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
4-263 PTHR11017:SF20,SUBFAMILY NOT NAMED

LRLIWSESAWIEDINKAVLKTLRYKYKNELTFNFKTDENYSKIQSSINFDSSKVQIIGIWGAKGIGKTAIVAAMFQNFSCKYQGTCFLEKVAEESKRNGINFTYKKLVSTLLGEDVNIDTPIVMSSMVIRRLKGMKAFIVLDDVRSPETLKTLIRERGGWLGAGSIVIVTTRDEDVLKSGGISNTHKVRNSLRISYLNKFTISLPKQGFLELSRKAIHYVNCNPIALKVLRSFHRLYTSEIDWKCALAKLKEISNAKIMR

HMMPanther: PTHR11017
4-263 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LRLIWSESAWIEDINKAVLKTLRYKYKNELTFNFKTDENYSKIQSSINFDSSKVQIIGIWGAKGIGKTAIVAAMFQNFSCKYQGTCFLEKVAEESKRNGINFTYKKLVSTLLGEDVNIDTPIVMSSMVIRRLKGMKAFIVLDDVRSPETLKTLIRERGGWLGAGSIVIVTTRDEDVLKSGGISNTHKVRNSLRISYLNKFTISLPKQGFLELSRKAIHYVNCNPIALKVLRSFHRLYTSEIDWKCALAKLKEISNAKIMR

Gene3D: G3DSA:3.40.50.300
25-181 G3DSA:3.40.50.300

LRYKYKNELTFNFKTDENYSKIQSSINFDSSKVQIIGIWGAKGIGKTAIVAAMFQNFSCKYQGTCFLEKVAEESKRNGINFTYKKLVSTLLGEDVNIDTPIVMSSMVIRRLKGMKAFIVLDDVRSPETLKTLIRERGGWLGAGSIVIVTTRDEDVLK

superfamily: SSF52540
30-261 SSF52540

KNELTFNFKTDENYSKIQSSINFDSSKVQIIGIWGAKGIGKTAIVAAMFQNFSCKYQGTCFLEKVAEESKRNGINFTYKKLVSTLLGEDVNIDTPIVMSSMVIRRLKGMKAFIVLDDVRSPETLKTLIRERGGWLGAGSIVIVTTRDEDVLKSGGISNTHKVRNSLRISYLNKFTISLPKQGFLELSRKAIHYVNCNPIALKVLRSFHRLYTSEIDWKCALAKLKEISNAKI

HMMPfam: PF00931
IPR002182
45-255 NB-ARC,NBS
NB-ARC

KIQSSINFDSSKVQIIGIWGAKGIGKTAIVAAMFQNFSCKYQGTCFLEKVAEESKRNGINFTYKKLVSTLLGEDVNIDTPIVMSSMVIRRLKGMKAFIVLDDVRSPETLKTLIRERGGWLGAGSIVIVTTRDEDVLKSGGISNTHKVRNSLRISYLNKFTISLPKQGFLELSRKAIHYVNCNPIALKVLRSFHRLYTSEIDWKCALAKLKE

FPrintScan: PR00364
IPR000767
59-74 DISEASERSIST
Disease resistance protein

IIGIWGAKGIGKTAIV

FPrintScan: PR00364
IPR000767
134-148 DISEASERSIST
Disease resistance protein

RLKGMKAFIVLDDVR

FPrintScan: PR00364
IPR000767
223-237 DISEASERSIST
Disease resistance protein

VNCNPIALKVLRSFH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox