PRGDB00044666 (Disease resistance protein; Calcium-binding EF-hand)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein; Calcium-binding EF-hand
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 62701970 (AC155880)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula chromosome 2 clone mte1-55i22, complete sequence.

DNA Sequence

ATGATTAACTCAACTTCAACTTCAACTCAAAGACCAGTTTTGGCTCTTTCTCACCAAGAAAACATTGAACACTTTGATATTGAGCAATTAGTGAGTCGTCTTAGACATAAGCTTTCAGGTAAAAAGTTTGTACTCGTCTTAGATGATATATGGGATGATAACCGTTCAAAATGGATTGAGTTGAAAGATCTGATAAAAGTTGGTGCAGTAGAAAGCAAAATCTTAGTGACAACACGTAGTAACTTGATTGCTTCGATGATGGGAACGGTTCCCATGTATACTTTAAAAGGTCTTTCTTTGGATAATTGTTTGTCTCTCTTTGTCAAATGGGCATTTAAGGAAGGAGAAGAAGTAAAGTATCCACATCTATCGGAGATTGGAAAAGATATAGCGAAAAAATGCCGAGGGATTCCATTAGCAGTGAAAACGTTAGGAAGTTCACTCTTCTCAAAATTTGATTTAGATAAGTGGAAGTTCGTCAGGGACTCCCAAATATGGAATTTAAGGCAAAACAAAGATGATATTTTACCTGTGCTTAAGTTAAGCTATGATCAAATGCCATCCTATTTGAGACATTGTTTTGCTTATTTTTCCCTTTTTCCCAAAGATTATCTTTTTACTCTTGGTGAAATTTGTAATCTATGGGATGTATTTGGATTAGTTCAATCACCAAATGGAAGTCAAAAGCTAGAGAACATTGCAAGAGATTATATAGATGAGTTACATTCAAGATCATTTCTTCAGGATTTTGAAGACTTTGGCCAGACATGTGTTTTCAAAGTACATGATTTGGTGCACGATCTTGCAATGTATGTAGCAAAAGACGCATTTGTGGTGGTAAACTCCTATACTCAAAATATACCTGAGCAAGCAAGACATTTATCAATTGTTGAAAATGACTCACTTGGTCATGCTTTGTTTTCCAAGTCGAAAAGTGTGAGAACTATTTTGTGTCCCATCCAAGGAGTAGGTGTCGATAGTGAAACTCTCTTGGATTCATGGATATCAAGATACAAATACTTGCGCTATTTAGATTTAAGTGATTCTTCATTTGAGGAGCTGCCTAATTCGATTTCTAAATTGGACCTTCTTCGAGTTCTCATTCTTTCTCGCAACAGCAAAATCAGAAGACTTCCTCATTCTATATGTGAACTCCAAAATTTGCAAGAGTTGTCAGTCAGAGGATGCATGGAGCTTGAAGCATTGCCTAAAGGACTAGGGAAGCTAATCAACCTTCGACAATTGTTTATAACAACAAAGCAATCTGTTTTGTCACATGATGAATTTGCAAGCATGCACCATCTTCAAACTTTGGGTTTTCATTATTGTGACAATTTGAAGTTTTTCTTTTACGCTGCACAACAACTCGCTTCCCTTGAAACATTGTTTGTTCAATCATGTGGGAGCCTAGAGGTCTTACCTCTATATTTTTCCTAA


Protein sequences

Name Description Sequence
Disease resistance protein; Calcium-binding EF-hand Disease resistance protein; Calcium-binding EF-hand [Medicago truncatula].

MINSTSTSTQRPVLALSHQENIEHFDIEQLVSRLRHKLSGKKFVLVLDDIWDDNRSKWIELKDLIKVGAVESKILVTTRSNLIASMMGTVPMYTLKGLSLDNCLSLFVKWAFKEGEEVKYPHLSEIGKDIAKKCRGIPLAVKTLGSSLFSKFDLDKWKFVRDSQIWNLRQNKDDILPVLKLSYDQMPSYLRHCFAYFSLFPKDYLFTLGEICNLWDVFGLVQSPNGSQKLENIARDYIDELHSRSFLQDFEDFGQTCVFKVHDLVHDLAMYVAKDAFVVVNSYTQNIPEQARHLSIVENDSLGHALFSKSKSVRTILCPIQGVGVDSETLLDSWISRYKYLRYLDLSDSSFEELPNSISKLDLLRVLILSRNSKIRRLPHSICELQNLQELSVRGCMELEALPKGLGKLINLRQLFITTKQSVLSHDEFASMHHLQTLGFHYCDNLKFFFYAAQQLASLETLFVQSCGSLEVLPLYFS

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
20-223 NB-ARC,NBS
NB-ARC

ENIEHFDIEQLVSRLRHKLSGKKFVLVLDDIWDDNRSKWIELKDLIKVGAVESKILVTTRSNLIASMMGTVPMYTLKGLSLDNCLSLFVKWAFKEGEEVKYPHLSEIGKDIAKKCRGIPLAVKTLGSSLFSKFDLDKWKFVRDSQIWNLRQNKDDILPVLKLSYDQMPSYLRHCFAYFSLFPKDYLFTLGEICNLWDVFGLVQS

superfamily: SSF52540
26-171 SSF52540

DIEQLVSRLRHKLSGKKFVLVLDDIWDDNRSKWIELKDLIKVGAVESKILVTTRSNLIASMMGTVPMYTLKGLSLDNCLSLFVKWAFKEGEEVKYPHLSEIGKDIAKKCRGIPLAVKTLGSSLFSKFDLDKWKFVRDSQIWNLRQN

FPrintScan: PR00364
IPR000767
37-51 DISEASERSIST
Disease resistance protein

KLSGKKFVLVLDDIW

HMMPanther: PTHR11017:SF28
38-417 PTHR11017:SF28

LSGKKFVLVLDDIWDDNRSKWIELKDLIKVGAVESKILVTTRSNLIASMMGTVPMYTLKGLSLDNCLSLFVKWAFKEGEEVKYPHLSEIGKDIAKKCRGIPLAVKTLGSSLFSKFDLDKWKFVRDSQIWNLRQNKDDILPVLKLSYDQMPSYLRHCFAYFSLFPKDYLFTLGEICNLWDVFGLVQSPNGSQKLENIARDYIDELHSRSFLQDFEDFGQTCVFKVHDLVHDLAMYVAKDAFVVVNSYTQNIPEQARHLSIVENDSLGHALFSKSKSVRTILCPIQGVGVDSETLLDSWISRYKYLRYLDLSDSSFEELPNSISKLDLLRVLILSRNSKIRRLPHSICELQNLQELSVRGCMELEALPKGLGKLINLRQLFI

HMMPanther: PTHR11017
38-417 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSGKKFVLVLDDIWDDNRSKWIELKDLIKVGAVESKILVTTRSNLIASMMGTVPMYTLKGLSLDNCLSLFVKWAFKEGEEVKYPHLSEIGKDIAKKCRGIPLAVKTLGSSLFSKFDLDKWKFVRDSQIWNLRQNKDDILPVLKLSYDQMPSYLRHCFAYFSLFPKDYLFTLGEICNLWDVFGLVQSPNGSQKLENIARDYIDELHSRSFLQDFEDFGQTCVFKVHDLVHDLAMYVAKDAFVVVNSYTQNIPEQARHLSIVENDSLGHALFSKSKSVRTILCPIQGVGVDSETLLDSWISRYKYLRYLDLSDSSFEELPNSISKLDLLRVLILSRNSKIRRLPHSICELQNLQELSVRGCMELEALPKGLGKLINLRQLFI

FPrintScan: PR00364
IPR000767
134-148 DISEASERSIST
Disease resistance protein

CRGIPLAVKTLGSSL

superfamily: SSF52058
260-478 SSF52058,LRR

KVHDLVHDLAMYVAKDAFVVVNSYTQNIPEQARHLSIVENDSLGHALFSKSKSVRTILCPIQGVGVDSETLLDSWISRYKYLRYLDLSDSSFEELPNSISKLDLLRVLILSRNSKIRRLPHSICELQNLQELSVRGCMELEALPKGLGKLINLRQLFITTKQSVLSHDEFASMHHLQTLGFHYCDNLKFFFYAAQQLASLETLFVQSCGSLEVLPLYFS

Gene3D: G3DSA:3.80.10.10
331-472 G3DSA:3.80.10.10

LDSWISRYKYLRYLDLSDSSFEELPNSISKLDLLRVLILSRNSKIRRLPHSICELQNLQELSVRGCMELEALPKGLGKLINLRQLFITTKQSVLSHDEFASMHHLQTLGFHYCDNLKFFFYAAQQLASLETLFVQSCGSLEV

HMMPfam: PF12799
340-375 LRR_4,Leucine Rich repeats (2 copies)

YLRYLDLSDSSFEELPNSISKLDLLRVLILSRNSKI

HMMPfam: PF00560
IPR001611
387-409 LRR_1
Leucine-rich repeat

NLQELSVRGCMELEALPKGLGKL

FPrintScan: PR00364
IPR000767
454-470 DISEASERSIST
Disease resistance protein

QQLASLETLFVQSCGSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox