PRGDB00044667 (Disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 50979357 (AC149134)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula clone mth2-19l15, complete sequence.

DNA Sequence

GAAGTATCAATAACACGAGCACCAGAGGATCATATACCTTCTAGTTTTGAAATGAAGATGAAGAAAGGAAAAAGTCATATGCCTGTTCTAGAAGACTTGTGCATAGGAAAATGTGATTTTCTAGAGTTTATATTTTTTCACAAAGAAAAAGTCAATTTCTTAGTTCCTTCACACTTGAAAACCATCAAAATTGAAAAGTGTGAGAAGTTAAAGACCATAGTTGCTAGCACAGAAAATAGAAAGGACGTGACAAACTCGTTTACTCAGTTAGTGTCACTTCACTTGAAAGATCTTCCACATCTTGTGAAGTTTAGCATTTGTGGACCATATGAGTCATGGAACAACCAAATAGACAAGGGATTGAGTTCTACAACTAAATTAACAGATTCAACAAACATCGAGGATGGTGAAACCTCCAGATCAAATCCAGATGGTTGTAGACCCTCATCAGTTAGTGGCAAGTTGTTTTCATCTAATTGGATCATACACTTTCCAAAGTTGGAAATAATGGAGTTACTAGAATGTAATTCCATAGAGATGGTATTTGACTTGGAAGGATATTCAGAATTGATCGGAAATGCACAAGATTTTCTGTTTCCTCAGCTAAGAAACGTTGAGATAATACAGATGCATAGTTTGTTATATGTGTGGGGTAATGTTCCATATCATATTCAAGGCTTTCATAATTTGAGAGTTCTAACGATCGAAGCATGTGGTTCTTTAAAATATGTATTTACTTCTGTCATTGTTAGAGCAATCACAAATCTTGAGGAATTGAGAGTAAGCTCTTGTAAAATGATTGAGAACATAATAGTTTACAGCAGAGATGGTAAAGAGGATGATACTATTAAAGGAGATGTGGCCGCAACTATTAGGTTTAATAAACTATGTTATTTATCTCTTTCTGGACTTCCAAAGCTTGTGAATATTTGTTCAGATTCTGTTGAGTTAGAATATCCATCCTTGAGGGAATTTAAGATTGATGATTGTCCAATGTTGAAGATATCTCTATCACCAACATATATCCATGCAAATCAAGACAGCCTCAACAATGTCACACATTCAAAAAATAAAGAAGATGATAATATTGAAGTAAACAACTCAAACTCGTCAACTTGCCCCCCTGCAGGGTGTACTCCTTTTCTGTCCAAATTCTTTCATAAAGGAAACGCAAATAAGAGAATTAACAAGATGGATTTTTGTATGGAGCTGCCAAAAGGAGCTGCCTCAAAACTTGGAGAAATGGGAGTGGAGTCTATCATAAAGCAATTTAAATATATGATCCAATACAAAAATATAATTGCCAATTTGAATGAAGAGCACAATAATTTGGATTCTTTGAGACAATCATTGCAAGGGTGGGTGGATGCAGAAAGCACAAAAGGAAACGAAATTCCACGTAACGTGTTGAACTGGCTCTCTAAAGAAGCAGAAATTGAAGCTGTGTTAGAAAGTTTCTATGAAAACAAAGTTAACAAGAACAAGAAGTGCTTTTGGGGCCAGTGTATAAATTTTGCATTCAATTACTCACTGGGTAAGCAAGCAACTGAAAAAATAGAAGTTGTTACAAGATTGAACGAGGAAGGAAAACAGCTTTCACTTATATCCTACCGTAAGGATGCACCAGCACTTGGATCAACCTTCATAGAAAATTACAAGAGTTTGGAGTCCAGAAACCAAATTATACAAGTGCTCATAGAGAAGTTGAAGGATGGTCAACTCAAAAGGATTGGCATTTGTGGGATGGGTGGAGTGGGGAAAACCACACTTGTGAAAGAACTCATCAAAACTGTAGAAAATAAGTTATTTGATAAAGTTGTGATGGCTGTTGTATCCCAAAATCCTGATTACGAGAAGATTCAAAGACAAATTGCTGATGGTTTAGGTTTGGAGTTAAAAGGGCAGAGTTTGGAAGGAAGGGGTTGGGAAATATTTCAAAGGTTTAAAGAATTTGAAGAGAAGAATGTTAAGGTGCTAATAGTCTTAGATGATGTGTGGAAAGAACTTAATTTTGAGTTGATAGGACTTTCTTCTCAAGACCATCAGAAATGTATAAAAATATTATTCACATCACGAGATGAAAAGGTGTGCCAACAGAATAGAAGCCAAGATAATGTACATGTCTCTGTGTTGCTCCACGATGAAGCTTGGAGCCTATTTCGAGAAATGGCTGGAAATGTTGCAAGCAAACCTGATATCAATCCAATAGCAAGTGAGGTTGCAAGGGAATGTGGTGGTTTGCCCCTTGCAATTGCAACAGTTGGACGAGCACTTGGCAACGAGGAAAAAAGTATGTGGGAGGTTGCCCTACAACAGCTGAGACAAGCTCAATCATCATCCTTCTCAAACATGCAGGAATGTGTATATTCACGAATTGAACTTAGCATCAATATATTGGGTGTTGAACACAAGTCATGCCTTTTCCTTTGTGGATTGTTTCCAGAGGACTTTGACATTCCTATAGAAAGCCTGTTGCGTCACGGGGTGGGCTTGGGGTTGTTTATGGTAGATGATTATGTTTGGAAAGCAAGAAATTATATAAACTATTTGGTGAATAGTCTGAAAAAATGTTTCCTATTGTTAGACAGTGAAGAACCAGGGTGTGTAAAGATGCATGATGTTGTGCGTGATGTTGTCCTAAAAATTTCATCCAGAGAAGAACTTGGGATTTTGGTGCAGTTTAATGTAGAATTAAAGAGGGTGAAAAAGAAACTAGCAAAATGGCGTAGGATGTCCCTTATTTTGGACGAGGATATTGAGTTAGAAAATGGCCTAGAATGTCCAACTCTAGAGCTTTTACAGGTTCTATGTCAAAGAGAAAATAGAGAAGTGAATATATGGCCAGAGAACTTTACCCATGGAATGACTAAACTCAAAGTTTTATATATTCAAAATGTGTGCATTCCAAAAACATTATCTCATTTCCATGCCTCAGTCAACCTTCGCACGCTGCAGCTAGAAGGATGTGATGTTGGAGATATATCTATAATTGGTAAAGAGTTAAATAAACTAGAAATCCTGAGCTTTGCCAATTCTAATATTGAAGAACTTCCACTTGAAATTGGGAATTTGGAGTTTCTCACATTATTGGATTTGACAGGATGTGATTATCTTAATTCTATTTCTCCTAATGTCTTAGCAAGGTTATCAAGTCTGGAAGAGTTTTATTTTAGGATAAAAAACTTTCCTTGGTTGCTAAACAGAGAAGTTCTCAATGAGTTAAGAAATATTTCTCCACAGTTGAAGGTTCTTGAGATCAGAGTAAGGAAGATGGAAATTTTACCATGTGATATGGATTTCAAAAACCTGGAATTTTTTTGGGTTTATATTGTTTCTAATGATTCTTATGAGCGCTGTGGATATTTGGAGCCAAATAGAATACAATTAAGAGATTTAGATTACAACTCTATCAAGAGTAGTGTGATGATCATGCAACTGTTCAAGAAATGTGAAATTCTCATATTAGAAGAAGTGAAGGACTTGAAAAATGTCATATCTGAATTGGATGATTGTGGACTCCAATGTGTGAGAGATTTAACCCTTGTTTCATGCCCCCATCTTGAGTGTGTCATAGATTGCAATACTCCATTCTCTGCATTCCCATTGATCAGGTCGTTGTGTTTATCGAAACTTGCCGAGATGAGAGAAATTATTCATGCACCTGATGACCAAGAAACCACAAAAGCAATTATCAAATTCTCAAATTTGGAGAAATTGGAGCTGATGTTCCTCGACAAGTTGATTGGCTTTATGAACTTCAGTTTTTTGAACGAGCATCATCAACTAATTCATAGT


Protein sequences

Name Description Sequence
Disease resistance protein Disease resistance protein [Medicago truncatula].

MDFCMELPKGAASKLGEMGVESIIKQFKYMIQYKNIIANLNEEHNNLDSLRQSLQGWVDAESTKGNEIPRNVLNWLSKEAEIEAVLESFYENKVNKNKKCFWGQCINFAFNYSLGKQATEKIEVVTRLNEEGKQLSLISYRKDAPALGSTFIENYKSLESRNQIIQVLIEKLKDGQLKRIGICGMGGVGKTTLVKELIKTVENKLFDKVVMAVVSQNPDYEKIQRQIADGLGLELKGQSLEGRGWEIFQRFKEFEEKNVKVLIVLDDVWKELNFELIGLSSQDHQKCIKILFTSRDEKVCQQNRSQDNVHVSVLLHDEAWSLFREMAGNVASKPDINPIASEVARECGGLPLAIATVGRALGNEEKSMWEVALQQLRQAQSSSFSNMQECVYSRIELSINILGVEHKSCLFLCGLFPEDFDIPIESLLRHGVGLGLFMVDDYVWKARNYINYLVNSLKKCFLLLDSEEPGCVKMHDVVRDVVLKISSREELGILVQFNVELKRVKKKLAKWRRMSLILDEDIELENGLECPTLELLQVLCQRENREVNIWPENFTHGMTKLKVLYIQNVCIPKTLSHFHASVNLRTLQLEGCDVGDISIIGKELNKLEILSFANSNIEELPLEIGNLEFLTLLDLTGCDYLNSISPNVLARLSSLEEFYFRIKNFPWLLNREVLNELRNISPQLKVLEIRVRKMEILPCDMDFKNLEFFWVYIVSNDSYERCGYLEPNRIQLRDLDYNSIKSSVMIMQLFKKCEILILEEVKDLKNVISELDDCGLQCVRDLTLVSCPHLECVIDCNTPFSAFPLIRSLCLSKLAEMREIIHAPDDQETTKAIIKFSNLEKLELMFLDKLIGFMNFSFLNEHHQLIHSGLSSTTKLTDSTNIEDGETSRSNPDGCRPSSVSGKLFSSNWIIHFPKLEIMELLECNSIEMVFDLEGYSELIGNAQDFLFPQLRNVEIIQMHSLLYVWGNVPYHIQGFHNLRVLTIEACGSLKYVFTSVIVRAITNLEELRVSSCKMIENIIVYSRDGKEDDTIKGDVAATIRFNKLCYLSLSGLPKLVNICSDSVELEYPSLREFKIDDCPMLKISLSPTYIHANQDSLNNVTHSKNKEDDNIEVNNSNSSTCPPAGCTPFLSKFFHKGNANKRINKEVSITRAPEDHIPSSFEMKMKKGKSHMPVLEDLCIGKCDFLEFIFFHKEKVNFLVPSHLKTIKIEKCEKLKTIVASTENRKDVTNSFTQLVSLHLKDLPHLVKFSICGPYESWNNQIDK

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
150-384 SSF52540

TFIENYKSLESRNQIIQVLIEKLKDGQLKRIGICGMGGVGKTTLVKELIKTVENKLFDKVVMAVVSQNPDYEKIQRQIADGLGLELKGQSLEGRGWEIFQRFKEFEEKNVKVLIVLDDVWKELNFELIGLSSQDHQKCIKILFTSRDEKVCQQNRSQDNVHVSVLLHDEAWSLFREMAGNVASKPDINPIASEVARECGGLPLAIATVGRALGNEEKSMWEVALQQLRQAQSSSF

HMMPanther: PTHR23155
159-1083 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ESRNQIIQVLIEKLKDGQLKRIGICGMGGVGKTTLVKELIKTVENKLFDKVVMAVVSQNPDYEKIQRQIADGLGLELKGQSLEGRGWEIFQRFKEFEEKNVKVLIVLDDVWKELNFELIGLSSQDHQKCIKILFTSRDEKVCQQNRSQDNVHVSVLLHDEAWSLFREMAGNVASKPDINPIASEVARECGGLPLAIATVGRALGNEEKSMWEVALQQLRQAQSSSFSNMQECVYSRIELSINILGVEHKSCLFLCGLFPEDFDIPIESLLRHGVGLGLFMVDDYVWKARNYINYLVNSLKKCFLLLDSEEPGCVKMHDVVRDVVLKISSREELGILVQFNVELKRVKKKLAKWRRMSLILDEDIELENGLECPTLELLQVLCQRENREVNIWPENFTHGMTKLKVLYIQNVCIPKTLSHFHASVNLRTLQLEGCDVGDISIIGKELNKLEILSFANSNIEELPLEIGNLEFLTLLDLTGCDYLNSISPNVLARLSSLEEFYFRIKNFPWLLNREVLNELRNISPQLKVLEIRVRKMEILPCDMDFKNLEFFWVYIVSNDSYERCGYLEPNRIQLRDLDYNSIKSSVMIMQLFKKCEILILEEVKDLKNVISELDDCGLQCVRDLTLVSCPHLECVIDCNTPFSAFPLIRSLCLSKLAEMREIIHAPDDQETTKAIIKFSNLEKLELMFLDKLIGFMNFSFLNEHHQLIHSGLSSTTKLTDSTNIEDGETSRSNPDGCRPSSVSGKLFSSNWIIHFPKLEIMELLECNSIEMVFDLEGYSELIGNAQDFLFPQLRNVEIIQMHSLLYVWGNVPYHIQGFHNLRVLTIEACGSLKYVFTSVIVRAITNLEELRVSSCKMIENIIVYSRDGKEDDTIKGDVAATIRFNKLCYLSLSGLPKLVNICSDSVELEYPSLREFKIDDCPMLK

HMMPanther: PTHR23155:SF121
159-1083 PTHR23155:SF121,SUBFAMILY NOT NAMED

ESRNQIIQVLIEKLKDGQLKRIGICGMGGVGKTTLVKELIKTVENKLFDKVVMAVVSQNPDYEKIQRQIADGLGLELKGQSLEGRGWEIFQRFKEFEEKNVKVLIVLDDVWKELNFELIGLSSQDHQKCIKILFTSRDEKVCQQNRSQDNVHVSVLLHDEAWSLFREMAGNVASKPDINPIASEVARECGGLPLAIATVGRALGNEEKSMWEVALQQLRQAQSSSFSNMQECVYSRIELSINILGVEHKSCLFLCGLFPEDFDIPIESLLRHGVGLGLFMVDDYVWKARNYINYLVNSLKKCFLLLDSEEPGCVKMHDVVRDVVLKISSREELGILVQFNVELKRVKKKLAKWRRMSLILDEDIELENGLECPTLELLQVLCQRENREVNIWPENFTHGMTKLKVLYIQNVCIPKTLSHFHASVNLRTLQLEGCDVGDISIIGKELNKLEILSFANSNIEELPLEIGNLEFLTLLDLTGCDYLNSISPNVLARLSSLEEFYFRIKNFPWLLNREVLNELRNISPQLKVLEIRVRKMEILPCDMDFKNLEFFWVYIVSNDSYERCGYLEPNRIQLRDLDYNSIKSSVMIMQLFKKCEILILEEVKDLKNVISELDDCGLQCVRDLTLVSCPHLECVIDCNTPFSAFPLIRSLCLSKLAEMREIIHAPDDQETTKAIIKFSNLEKLELMFLDKLIGFMNFSFLNEHHQLIHSGLSSTTKLTDSTNIEDGETSRSNPDGCRPSSVSGKLFSSNWIIHFPKLEIMELLECNSIEMVFDLEGYSELIGNAQDFLFPQLRNVEIIQMHSLLYVWGNVPYHIQGFHNLRVLTIEACGSLKYVFTSVIVRAITNLEELRVSSCKMIENIIVYSRDGKEDDTIKGDVAATIRFNKLCYLSLSGLPKLVNICSDSVELEYPSLREFKIDDCPMLK

HMMPfam: PF00931
IPR002182
163-429 NB-ARC,NBS
NB-ARC

QIIQVLIEKLKDGQLKRIGICGMGGVGKTTLVKELIKTVENKLFDKVVMAVVSQNPDYEKIQRQIADGLGLELKGQSLEGRGWEIFQRFKEFEEKNVKVLIVLDDVWKELNFELIGLSSQDHQKCIKILFTSRDEKVCQQNRSQDNVHVSVLLHDEAWSLFREMAGNVASKPDINPIASEVARECGGLPLAIATVGRALGNEEKSMWEVALQQLRQAQSSSFSNMQECVYSRIELSINILGVEHKSCLFLCGLFPEDFDIPIESLLR

Gene3D: G3DSA:3.40.50.300
163-271 G3DSA:3.40.50.300

QIIQVLIEKLKDGQLKRIGICGMGGVGKTTLVKELIKTVENKLFDKVVMAVVSQNPDYEKIQRQIADGLGLELKGQSLEGRGWEIFQRFKEFEEKNVKVLIVLDDVWKE

FPrintScan: PR00364
IPR000767
179-194 DISEASERSIST
Disease resistance protein

RIGICGMGGVGKTTLV

FPrintScan: PR00364
IPR000767
255-269 DISEASERSIST
Disease resistance protein

EEKNVKVLIVLDDVW

FPrintScan: PR00364
IPR000767
347-361 DISEASERSIST
Disease resistance protein

CGGLPLAIATVGRAL

superfamily: SSF52058
473-877 SSF52058,LRR

KMHDVVRDVVLKISSREELGILVQFNVELKRVKKKLAKWRRMSLILDEDIELENGLECPTLELLQVLCQRENREVNIWPENFTHGMTKLKVLYIQNVCIPKTLSHFHASVNLRTLQLEGCDVGDISIIGKELNKLEILSFANSNIEELPLEIGNLEFLTLLDLTGCDYLNSISPNVLARLSSLEEFYFRIKNFPWLLNREVLNELRNISPQLKVLEIRVRKMEILPCDMDFKNLEFFWVYIVSNDSYERCGYLEPNRIQLRDLDYNSIKSSVMIMQLFKKCEILILEEVKDLKNVISELDDCGLQCVRDLTLVSCPHLECVIDCNTPFSAFPLIRSLCLSKLAEMREIIHAPDDQETTKAIIKFSNLEKLELMFLDKLIGFMNFSFLNEHHQLIHSGLSSTTKLT

Gene3D: G3DSA:3.80.10.10
533-674 G3DSA:3.80.10.10

LELLQVLCQRENREVNIWPENFTHGMTKLKVLYIQNVCIPKTLSHFHASVNLRTLQLEGCDVGDISIIGKELNKLEILSFANSNIEELPLEIGNLEFLTLLDLTGCDYLNSISPNVLARLSSLEEFYFRIKNFPWLLNREVL

FPrintScan: PR00364
IPR000767
625-641 DISEASERSIST
Disease resistance protein

GNLEFLTLLDLTGCDYL

superfamily: SSF52047
909-1220 SSF52047,LRR

WIIHFPKLEIMELLECNSIEMVFDLEGYSELIGNAQDFLFPQLRNVEIIQMHSLLYVWGNVPYHIQGFHNLRVLTIEACGSLKYVFTSVIVRAITNLEELRVSSCKMIENIIVYSRDGKEDDTIKGDVAATIRFNKLCYLSLSGLPKLVNICSDSVELEYPSLREFKIDDCPMLKISLSPTYIHANQDSLNNVTHSKNKEDDNIEVNNSNSSTCPPAGCTPFLSKFFHKGNANKRINKEVSITRAPEDHIPSSFEMKMKKGKSHMPVLEDLCIGKCDFLEFIFFHKEKVNFLVPSHLKTIKIEKCEKLKTIV

Gene3D: G3DSA:3.80.10.10
933-1079 G3DSA:3.80.10.10

LEGYSELIGNAQDFLFPQLRNVEIIQMHSLLYVWGNVPYHIQGFHNLRVLTIEACGSLKYVFTSVIVRAITNLEELRVSSCKMIENIIVYSRDGKEDDTIKGDVAATIRFNKLCYLSLSGLPKLVNICSDSVELEYPSLREFKIDDC

Gene3D: G3DSA:3.80.10.10
1152-1242 G3DSA:3.80.10.10

RAPEDHIPSSFEMKMKKGKSHMPVLEDLCIGKCDFLEFIFFHKEKVNFLVPSHLKTIKIEKCEKLKTIVASTENRKDVTNSFTQLVSLHLK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox