PRGDB00044668 (Disease resistance protein; Heat shock protein DnaJ, N-terminal; AAA ATPase)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein; Heat shock protein DnaJ, N-terminal; AAA ATPase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 50511507 (AC149642)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula chromosome 2 clone mth2-62p11, complete sequence.

DNA Sequence

ATGACGTTGGGAAAGGAAATTGTTGAGAGACTCAATGACGTGAATGCCATGCTTTCTAAAGCTCCTAATATGCAGATTGCTATTGAGCAACCACCTAAACCTGTTGATGAGATGCCTTTTGGTGAAACTATAGGCTTGAACTTGATGTTCAACAAAGTATGGAAAAGTCTTGAAGATAATAATGTGGGAATAATTGGTTTATATGGAATGGGTGGCGTCGGAAAAACTACCCTTATGAAGAGAATTCACAGTGAATTAGGAAAGATGGAGCATAGTTTTGATATAGTGTTGTGGGCAGTGGTTTCTAAAGATTGTGATATCAATAAAATCATGACTGACATCAGAAATAGGTTAGGGATTGATGAGAACTTTTGGAAAGAAAGTAGTCAAGATCAAAGAGTAACCAAGATTCATGAACAGTTGAAAGGAAAGAAGTTTGTATTGATGTTAGATGATTTATGGGGAAAGCTAGAACTAGAAGCGATAGGAGTTCCGGTCCCCAAAGAATGTAACAACAAATCAAAAGTTGTTTTCACAACACGGTCCAAGGATGTATGTGCTAAAATGAAAGCTGAAACGAAATTGGAAGTGAAATGTCTATCTGATGAACAAGCGTTTGATTTGTTTCGTAAGAAAGTAGGTGATGAGACATTAAAATGTCACACAGAGATCCCAAATCTAGCGCATGAAATGGCTAAAGAATGCGGAGGATTGCCGCTAGCATTAATCACTGTGGGAAGTGCCATGGCAGGGGTGGAAAGTTATGATGCTTGGATGGATGCGAGAAATAATTTGATGAGTTCTCCTTCGAAAGCCTCAGATTTTGTAAAAGTTTTTCGAATCCTCAAGTTTAGCTATGACAAACTTCCAGATAATGCACATAAAAGTTGTTTCTTGTACTGTGCACTATACCCAGAAGATTTTGAATTAGATGGTGATGAACTTATTGATCGATGGATTGGTGAGGGATTTCTCCATGAAGATGGTAAAAGTATGTATGGTATGTACATCAAAGGGAAAACTATTATTGAAAAATTAATAGTTTCATGCCTATTAGAGGAGGGTATTGGTACTGGAATTAACATTGTGGCTGGTTGGAGGAGTAGGAGAATTAAGATGCATGATGTGATTAGAGACATGGCACTGTGGTTAGGTCGAGATGAAGATGAAAACAAAGACAAAATTGTAGTTCAAAGGGAAGCAATTTCCATGTCGGAAATGAATTTTGAAAGATTAAATGTTGTAAAGAGGATTTCAGTAATAACTAGGTTGGATTCAAAAGAAAGCTTGAAGGTACCAACTTGTCCAAATCTCATCACCCTTTGTTTAAGTTTAGAAATGGATTTAGGGATGGATTTGAATGCTCCTGTTTTATCATTAAATTTCCAATCCATAAAAAAGCTGAGAGTATTGGATTTATCAAGGGATCTTTGTATAAAGAACCTGTCCTCAGGAATAGGCGAGTTAGTGAACTTGGAATTCCTTAACCTCTCAGGATCAAAAGTATTTGAGTTGCCTATTGCATTGAAGAAGTTGAAAAAGTTGAGGGTACTCCTTATGGATGATATGTATTACTACGATTATGCTAAAATCATTCCTTTGGAAGTGATAGAAAGTCTTGAACAATTAAAGGTGTTTAGATTTAGTACACGTGATTTATGTTCCAGTCCAGTACAAAAAGAGATATCATTATTAGAGAAGCTGGAATCATTACCAAAATTGGAGGAACTGAGCCTGGAATTAAGAAACTTCACTAGTGTGCAGAGACTATTTCAATCCACCAAATTACGAGATTGCTCTAGATGCCTTGGGATTTCTTTTTCAAACAAGGAGGGGTCACAGTCACTTGAAATGTCTTCATTATTAAAATCCATGTCAAAAATGAGGCATTTGGACAGCATACGTCTTTGGGCTAGAAACAACCTCATGGATGGTTCATCGATTGCTGACAAATGCGATCTTGGAAATCTTCGCCGAGTGCACATAAGTAGTTGTCATTCAATAAATCATTTGACATGGTTGATGTATGCTCCGCTTCTTGAGATCCTTGTTGTTGGTCTTTGTGATTCAATTGAAGAGGTGGTGAAAGAAGGTAAAGATAACGAACAAGCTGGATCTGACTCCAAAAATGATATGATATTTGCAAATCTTACAGATCTTTGCCTTTATGGTATGCCAAAACTAGTGAGCATCCACAAGAGAGCTTTGGATTTTCCTTCCCTAAAACGTATTAAGGTAACTGATTGCCCCAATCTGAGGAAGCTTCCTTTCAATTCCAGGTTTGCTTTCAAGATTAACTTGATTGCAATCCAAGGTGAGACAGAGTGGTGGGACAATTTAGAGTGGGATGACACAATTATTCCAACCTTGCTACGTCCTAAACTTATAGAGAGTAGTAGTATTAAACTATTATTCAAGTGA


Protein sequences

Name Description Sequence
Disease resistance protein; Heat shock protein DnaJ, N-terminal; AAA ATPase Disease resistance protein; Heat shock protein DnaJ, N-terminal; AAA ATPase [Medicago truncatula].

MTLGKEIVERLNDVNAMLSKAPNMQIAIEQPPKPVDEMPFGETIGLNLMFNKVWKSLEDNNVGIIGLYGMGGVGKTTLMKRIHSELGKMEHSFDIVLWAVVSKDCDINKIMTDIRNRLGIDENFWKESSQDQRVTKIHEQLKGKKFVLMLDDLWGKLELEAIGVPVPKECNNKSKVVFTTRSKDVCAKMKAETKLEVKCLSDEQAFDLFRKKVGDETLKCHTEIPNLAHEMAKECGGLPLALITVGSAMAGVESYDAWMDARNNLMSSPSKASDFVKVFRILKFSYDKLPDNAHKSCFLYCALYPEDFELDGDELIDRWIGEGFLHEDGKSMYGMYIKGKTIIEKLIVSCLLEEGIGTGINIVAGWRSRRIKMHDVIRDMALWLGRDEDENKDKIVVQREAISMSEMNFERLNVVKRISVITRLDSKESLKVPTCPNLITLCLSLEMDLGMDLNAPVLSLNFQSIKKLRVLDLSRDLCIKNLSSGIGELVNLEFLNLSGSKVFELPIALKKLKKLRVLLMDDMYYYDYAKIIPLEVIESLEQLKVFRFSTRDLCSSPVQKEISLLEKLESLPKLEELSLELRNFTSVQRLFQSTKLRDCSRCLGISFSNKEGSQSLEMSSLLKSMSKMRHLDSIRLWARNNLMDGSSIADKCDLGNLRRVHISSCHSINHLTWLMYAPLLEILVVGLCDSIEEVVKEGKDNEQAGSDSKNDMIFANLTDLCLYGMPKLVSIHKRALDFPSLKRIKVTDCPNLRKLPFNSRFAFKINLIAIQGETEWWDNLEWDDTIIPTLLRPKLIESSSIKLLFK

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
25-271 SSF52540

QIAIEQPPKPVDEMPFGETIGLNLMFNKVWKSLEDNNVGIIGLYGMGGVGKTTLMKRIHSELGKMEHSFDIVLWAVVSKDCDINKIMTDIRNRLGIDENFWKESSQDQRVTKIHEQLKGKKFVLMLDDLWGKLELEAIGVPVPKECNNKSKVVFTTRSKDVCAKMKAETKLEVKCLSDEQAFDLFRKKVGDETLKCHTEIPNLAHEMAKECGGLPLALITVGSAMAGVESYDAWMDARNNLMSSPSK

HMMPanther: PTHR23155:SF118
29-776 PTHR23155:SF118,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

EQPPKPVDEMPFGETIGLNLMFNKVWKSLEDNNVGIIGLYGMGGVGKTTLMKRIHSELGKMEHSFDIVLWAVVSKDCDINKIMTDIRNRLGIDENFWKESSQDQRVTKIHEQLKGKKFVLMLDDLWGKLELEAIGVPVPKECNNKSKVVFTTRSKDVCAKMKAETKLEVKCLSDEQAFDLFRKKVGDETLKCHTEIPNLAHEMAKECGGLPLALITVGSAMAGVESYDAWMDARNNLMSSPSKASDFVKVFRILKFSYDKLPDNAHKSCFLYCALYPEDFELDGDELIDRWIGEGFLHEDGKSMYGMYIKGKTIIEKLIVSCLLEEGIGTGINIVAGWRSRRIKMHDVIRDMALWLGRDEDENKDKIVVQREAISMSEMNFERLNVVKRISVITRLDSKESLKVPTCPNLITLCLSLEMDLGMDLNAPVLSLNFQSIKKLRVLDLSRDLCIKNLSSGIGELVNLEFLNLSGSKVFELPIALKKLKKLRVLLMDDMYYYDYAKIIPLEVIESLEQLKVFRFSTRDLCSSPVQKEISLLEKLESLPKLEELSLELRNFTSVQRLFQSTKLRDCSRCLGISFSNKEGSQSLEMSSLLKSMSKMRHLDSIRLWARNNLMDGSSIADKCDLGNLRRVHISSCHSINHLTWLMYAPLLEILVVGLCDSIEEVVKEGKDNEQAGSDSKNDMIFANLTDLCLYGMPKLVSIHKRALDFPSLKRIKVTDCPNLRKLPFNSRFAFKINLIAIQGETEW

HMMPanther: PTHR23155
29-776 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EQPPKPVDEMPFGETIGLNLMFNKVWKSLEDNNVGIIGLYGMGGVGKTTLMKRIHSELGKMEHSFDIVLWAVVSKDCDINKIMTDIRNRLGIDENFWKESSQDQRVTKIHEQLKGKKFVLMLDDLWGKLELEAIGVPVPKECNNKSKVVFTTRSKDVCAKMKAETKLEVKCLSDEQAFDLFRKKVGDETLKCHTEIPNLAHEMAKECGGLPLALITVGSAMAGVESYDAWMDARNNLMSSPSKASDFVKVFRILKFSYDKLPDNAHKSCFLYCALYPEDFELDGDELIDRWIGEGFLHEDGKSMYGMYIKGKTIIEKLIVSCLLEEGIGTGINIVAGWRSRRIKMHDVIRDMALWLGRDEDENKDKIVVQREAISMSEMNFERLNVVKRISVITRLDSKESLKVPTCPNLITLCLSLEMDLGMDLNAPVLSLNFQSIKKLRVLDLSRDLCIKNLSSGIGELVNLEFLNLSGSKVFELPIALKKLKKLRVLLMDDMYYYDYAKIIPLEVIESLEQLKVFRFSTRDLCSSPVQKEISLLEKLESLPKLEELSLELRNFTSVQRLFQSTKLRDCSRCLGISFSNKEGSQSLEMSSLLKSMSKMRHLDSIRLWARNNLMDGSSIADKCDLGNLRRVHISSCHSINHLTWLMYAPLLEILVVGLCDSIEEVVKEGKDNEQAGSDSKNDMIFANLTDLCLYGMPKLVSIHKRALDFPSLKRIKVTDCPNLRKLPFNSRFAFKINLIAIQGETEW

HMMPfam: PF00931
IPR002182
49-327 NB-ARC,NBS
NB-ARC

MFNKVWKSLEDNNVGIIGLYGMGGVGKTTLMKRIHSELGKMEHSFDIVLWAVVSKDCDINKIMTDIRNRLGIDENFWKESSQDQRVTKIHEQLKGKKFVLMLDDLWGKLELEAIGVPVPKECNNKSKVVFTTRSKDVCAKMKAETKLEVKCLSDEQAFDLFRKKVGDETLKCHTEIPNLAHEMAKECGGLPLALITVGSAMAGVESYDAWMDARNNLMSSPSKASDFVKVFRILKFSYDKLPDNAHKSCFLYCALYPEDFELDGDELIDRWIGEGFLHE

Gene3D: G3DSA:3.40.50.300
58-184 G3DSA:3.40.50.300

EDNNVGIIGLYGMGGVGKTTLMKRIHSELGKMEHSFDIVLWAVVSKDCDINKIMTDIRNRLGIDENFWKESSQDQRVTKIHEQLKGKKFVLMLDDLWGKLELEAIGVPVPKECNNKSKVVFTTRSKD

HMMSmart: SM00382
IPR003593
61-202 AAA,NBS
AAA+ ATPase domain

NVGIIGLYGMGGVGKTTLMKRIHSELGKMEHSFDIVLWAVVSKDCDINKIMTDIRNRLGIDENFWKESSQDQRVTKIHEQLKGKKFVLMLDDLWGKLELEAIGVPVPKECNNKSKVVFTTRSKDVCAKMKAETKLEVKCLSD

FPrintScan: PR00364
IPR000767
64-79 DISEASERSIST
Disease resistance protein

IIGLYGMGGVGKTTLM

FPrintScan: PR00364
IPR000767
140-154 DISEASERSIST
Disease resistance protein

QLKGKKFVLMLDDLW

FPrintScan: PR00364
IPR000767
235-249 DISEASERSIST
Disease resistance protein

CGGLPLALITVGSAM

superfamily: SSF52058
372-756 SSF52058,LRR

KMHDVIRDMALWLGRDEDENKDKIVVQREAISMSEMNFERLNVVKRISVITRLDSKESLKVPTCPNLITLCLSLEMDLGMDLNAPVLSLNFQSIKKLRVLDLSRDLCIKNLSSGIGELVNLEFLNLSGSKVFELPIALKKLKKLRVLLMDDMYYYDYAKIIPLEVIESLEQLKVFRFSTRDLCSSPVQKEISLLEKLESLPKLEELSLELRNFTSVQRLFQSTKLRDCSRCLGISFSNKEGSQSLEMSSLLKSMSKMRHLDSIRLWARNNLMDGSSIADKCDLGNLRRVHISSCHSINHLTWLMYAPLLEILVVGLCDSIEEVVKEGKDNEQAGSDSKNDMIFANLTDLCLYGMPKLVSIHKRALDFPSLKRIKVTDCPNLRKLP

Gene3D: G3DSA:3.80.10.10
437-756 G3DSA:3.80.10.10

NLITLCLSLEMDLGMDLNAPVLSLNFQSIKKLRVLDLSRDLCIKNLSSGIGELVNLEFLNLSGSKVFELPIALKKLKKLRVLLMDDMYYYDYAKIIPLEVIESLEQLKVFRFSTRDLCSSPVQKEISLLEKLESLPKLEELSLELRNFTSVQRLFQSTKLRDCSRCLGISFSNKEGSQSLEMSSLLKSMSKMRHLDSIRLWARNNLMDGSSIADKCDLGNLRRVHISSCHSINHLTWLMYAPLLEILVVGLCDSIEEVVKEGKDNEQAGSDSKNDMIFANLTDLCLYGMPKLVSIHKRALDFPSLKRIKVTDCPNLRKLP

FPrintScan: PR00364
IPR000767
463-479 DISEASERSIST
Disease resistance protein

QSIKKLRVLDLSRDLCI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox