PRGDB00044669 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 90110668 (DQ205351)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum disease resistance protein mRNA, complete cds.

DNA Sequence

ATGGCTGAGTCAGCTGTGAGAACCGTGCTTGGGAGCGTGGGCAACCTTGCAGTCCAGGAGACCACATTCTTGTGTGCAGTCAACCTTGAAGTGGGGTTGTTGAAAGATGAACTGATGAGGTTGCAGGCCTACCTCAAAGATGTTGATTGCAAGTGGAGATCAGGAAATGCAAGGGTTGCAGTCTTGGTGAGCCAGATCAGGGCTGCGGCTTATGAAGCTCAGAATGTCGTTGAAGCTGCAGATCACATGGAGAAGAGAATTAGGCTCAAGAAGGGATTCATGGGTGCTATTTCAAGGTATGCTCGCCTACCGACTGACTTGGTCACCCTTCGTAAAATCGGTGTTGAAATTCAATATGTAAGAAGGAAGCTAAATGAGATTTTTGCAAGTGCGGATCATCTAAAAATTGAATTGGATAATATTGTTGTTGTCGAGGATGAGTTTCTACGAGATTGTGGCCCTATGAATGGAAACTTTGAAGATGATGCCGTCATGGTCGGTTTTGAGGACGAGCACAAAGAATTAGCAAATAAATTAGTTTCCGGAGAACAAATGCTTAGTGTTGTGTCTATAGTTGCCATGGGCGGGGCAGGAAAAACAACGCTTGCTAGAAAAGTCTACACTTCATCTAGAGTCAAAGAGCACTTTGACACACTTGCTTGGGTGACTGTATCTCAAAAGTTTAAGGGCATTGATCTGCTAAAGGATATCATGAAACAAATAACAGGGCACAAAGATGAGTCAGTTAACCAAATGGCGGAGTATAAGGTGGGAAAGAAGATCAATGAATTTCTTTTAGAAAATAAATACTTGGTTGTCCTCGATGATGTTTGGGAAACAGATACATGGGTGCAATTAAACAGAATGATTACAGTTTTTCCAGATGCAACTAATGGTAGTAGAGTACTGTTAACCACACGAAAAGAAGATGTTGCAAACCATATTCAAATGCCAACCCATGTTCATCCTTTGAAGAAATTAGATGAAGAGAAAAGTTGGCAACTTTTTAGTAGCAAAGCTTTACCAACATACAAAAGGTCTGCCATACTTGATGTTGACGAGTTTGAAAAGCTTGGGAGAAAGCTTGCAAAGAAATGTGATGGATTGCCACTAGCGTTGAGAGTTTTGGGAGGTTATCTGTCTAAAAATCTAAATGCACAAATATGGTCCGATATACTCACTGATTGGCCAGCAACCAAGGATGGACAAATAATGAGTGTCATACTGGCACGCAGTTACAAGGACCTACCAAATCATCATTTGAGATCTTGTTTACTTTATTTTGCTGCTTTTCCGGAGGATTATGAAATATATGTGACGCATCTTATTGAGTTGTGGATAGCGGAAAGTTTCATTCCACATACACCAAACCATACACTAGAAGAAACAGCACGGAGCTATGTAACCGAGTTGGCTCAGAGAAGCTTGGTCCAAGTTGTTCGCAGAAGTACGGCGTATGGATGGATAGAGAGAATAAGGATTCACGATATCTTGCATGACTGGTGCATACAAGAAGCAAGACAAGATGGTTTTCTTGATACCAGCAACAAAACTGCAGGCCAAGCTGGTGCATCATCATCATCATCTGATAACTTGATATGTTATCGTTTTAGTTTTCAAACATTGAGTGATCAGATTTTACCTGCAACACCTAATGTCCGAAGTCTGCTTGGCTTTGAGCTTGAGTCAGTGTCCCTTCCTAAGCTGAGATTCCTGAGAGTTCTTTGCATTGAAAACTCAACACTAAAAGATTTCTCCAGTGTAATTGGTGGGTGCATTCACCTGTTGCTGGCGTATATGCCCTATAATCCTGAAGAAGATGACATCACACAAAAGGAGCTGCGGCAGAAAGGATGCAAGGTGGAAAATAGGTGGGACCTTCCATGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Triticum aestivum].

MAESAVRTVLGSVGNLAVQETTFLCAVNLEVGLLKDELMRLQAYLKDVDCKWRSGNARVAVLVSQIRAAAYEAQNVVEAADHMEKRIRLKKGFMGAISRYARLPTDLVTLRKIGVEIQYVRRKLNEIFASADHLKIELDNIVVVEDEFLRDCGPMNGNFEDDAVMVGFEDEHKELANKLVSGEQMLSVVSIVAMGGAGKTTLARKVYTSSRVKEHFDTLAWVTVSQKFKGIDLLKDIMKQITGHKDESVNQMAEYKVGKKINEFLLENKYLVVLDDVWETDTWVQLNRMITVFPDATNGSRVLLTTRKEDVANHIQMPTHVHPLKKLDEEKSWQLFSSKALPTYKRSAILDVDEFEKLGRKLAKKCDGLPLALRVLGGYLSKNLNAQIWSDILTDWPATKDGQIMSVILARSYKDLPNHHLRSCLLYFAAFPEDYEIYVTHLIELWIAESFIPHTPNHTLEETARSYVTELAQRSLVQVVRRSTAYGWIERIRIHDILHDWCIQEARQDGFLDTSNKTAGQAGASSSSSDNLICYRFSFQTLSDQILPATPNVRSLLGFELESVSLPKLRFLRVLCIENSTLKDFSSVIGGCIHLLLAYMPYNPEEDDITQKELRQKGCKVENRWDLP

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
142-404 SSF52540

VVVEDEFLRDCGPMNGNFEDDAVMVGFEDEHKELANKLVSGEQMLSVVSIVAMGGAGKTTLARKVYTSSRVKEHFDTLAWVTVSQKFKGIDLLKDIMKQITGHKDESVNQMAEYKVGKKINEFLLENKYLVVLDDVWETDTWVQLNRMITVFPDATNGSRVLLTTRKEDVANHIQMPTHVHPLKKLDEEKSWQLFSSKALPTYKRSAILDVDEFEKLGRKLAKKCDGLPLALRVLGGYLSKNLNAQIWSDILTDWPATKDGQI

HMMPfam: PF00931
IPR002182
169-453 NB-ARC,NBS
NB-ARC

EDEHKELANKLVSGEQMLSVVSIVAMGGAGKTTLARKVYTSSRVKEHFDTLAWVTVSQKFKGIDLLKDIMKQITGHKDESVNQMAEYKVGKKINEFLLENKYLVVLDDVWETDTWVQLNRMITVFPDATNGSRVLLTTRKEDVANHIQMPTHVHPLKKLDEEKSWQLFSSKALPTYKRSAILDVDEFEKLGRKLAKKCDGLPLALRVLGGYLSKNLNAQIWSDILTDWPATKDGQIMSVILARSYKDLPNHHLRSCLLYFAAFPEDYEIYVTHLIELWIAESFIP

Gene3D: G3DSA:3.40.50.300
184-314 G3DSA:3.40.50.300

QMLSVVSIVAMGGAGKTTLARKVYTSSRVKEHFDTLAWVTVSQKFKGIDLLKDIMKQITGHKDESVNQMAEYKVGKKINEFLLENKYLVVLDDVWETDTWVQLNRMITVFPDATNGSRVLLTTRKEDVANH

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

VVSIVAMGGAGKTTLA

HMMPanther: PTHR11017
189-512 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VSIVAMGGAGKTTLARKVYTSSRVKEHFDTLAWVTVSQKFKGIDLLKDIMKQITGHKDESVNQMAEYKVGKKINEFLLENKYLVVLDDVWETDTWVQLNRMITVFPDATNGSRVLLTTRKEDVANHIQMPTHVHPLKKLDEEKSWQLFSSKALPTYKRSAILDVDEFEKLGRKLAKKCDGLPLALRVLGGYLSKNLNAQIWSDILTDWPATKDGQIMSVILARSYKDLPNHHLRSCLLYFAAFPEDYEIYVTHLIELWIAESFIPHTPNHTLEETARSYVTELAQRSLVQVVRRSTAYGWIERIRIHDILHDWCIQEARQDGFL

FPrintScan: PR00364
IPR000767
264-278 DISEASERSIST
Disease resistance protein

FLLENKYLVVLDDVW

FPrintScan: PR00364
IPR000767
366-380 DISEASERSIST
Disease resistance protein

CDGLPLALRVLGGYL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox