PRGDB00044670 (At1g27170)

From PRG Wiki
Jump to: navigation, search
At1g27170
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 104647647 (DQ528644)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis lyrata

Comment?

Arabidopsis lyrata disease resistance protein (At1g27170) gene, partial cds.

DNA Sequence

CCCTAGAGAAGCTTGTTCTTGAGCGATGCAACCTTCTGGTGAAGGTTCCTAGATCAGTTGGTAATCTGAGAAAATTGCTTCAGCTGGACCTCCGAAGGTGCTCAAATCTTTCTGAATTTCTTGTGGATGTTTCTGGACTGAAGTGTCTTGAAAAACTTTTCCTCTCTGGCTGTTCAAATCTGAGCGTGTTACCAGAAAACATTGGTTCCATGCCATGTTTGAAAGAGCTTCTTCTTGATGGAACTGCGATAAGTAACTTACCGGACTCTATTTTTCGCCTCCAAAAGCTTGAAAAGCTTAGTCTAATGGGTTGCAGGTCTATTCAAGAGCTACCTACGTGCATAGGAAAATTGACATCGCTGGAAGATCTATATCTTGATGATACCGCATTGCGAAACCTTCCGAATTCTATTGGAGATCTTAAAAATCTCCAGAAGCTGCATTTGATGCGCTGCACATCCCTTTCTAAGATTCCTGACAGTATCAATGAGCTCATATCGTTGAAGAAACTATTCATCACCGGAAGCGCGGTGGAGGAGTTACCTCTAAAACCGAGCTCGCTGCCAAGTTTGACTGACTTCTCAGCAGGAGGTTGCAAATTTCTGAAACAAGTGCCGAGTTCAATTGGTGGATTAAATTCTCTTCTCCAACTTCAGTTGAATACCACCCTAATTGAAGCTCTACCAAAAGAGATTGGTGCCTTGCATTTTATACGCAAACTTGAGTTGATGAACTGTGAATTTCTGAAGTTTCTTCCCAAGTCAATTGGAGATATGGACACACTCTGTAGCTTAAACCTTGAAGGCTCTAACATTGAGGAACTGCCGGAAGAATTTGGCAAGCTGGAAAATCTAGTTGAATTGCGAATGAGCAACTGTACAATGCTCAAGAGGCTTCCTGAATCGTTTGGAGACTTGAAATCTCTTCACCATCTGTACATGAAGGAAACTTTGGTCTCAGAGTTGCCAGAAAGTTTTGGAAACCTCTCAAAGTTAATGGTACTGGAAATGCTGAAGAACCCTCTTTTTAGAATTTCTGAGAGTAATGCTCCAGGTACAAGCGAAGAACCTCGTTTTGTAGAAGTACCAAACTCTTTTTCAAACCTCACGTCACTTGAGGAACTAGATGCTCGCAGCTGGAGAATATCTGGTAAAATCCCGGATGATCTTGAGAAGCTTTCGTCTTTGATGAAACTGAATCTGGGGAATAATTATTTTCACAGTCTTCCGTCTAGCCTTGTTGGGTTATCAAATCTCCAAGAACTTTCATTACGTGACTGCCGAGAGCTCAAGCGTCTTCCCCCTCTCCCATGTAAACTGGAGCATCTAAACATGGCAAACTGCTTCTCATTGGAGAGTGTATCCGACCTTTCAGAGCTAACGATCTTGGAGGATCTCAATCTCACAAATTGTGGGAAAGTGGTTGATATTCCAGGCCTAGAGCACTTGATG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis lyrata].

LEKLVLERCNLLVKVPRSVGNLRKLLQLDLRRCSNLSEFLVDVSGLKCLEKLFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPDSIFRLQKLEKLSLMGCRSIQELPTCIGKLTSLEDLYLDDTALRNLPNSIGDLKNLQKLHLMRCTSLSKIPDSINELISLKKLFITGSAVEELPLKPSSLPSLTDFSAGGCKFLKQVPSSIGGLNSLLQLQLNTTLIEALPKEIGALHFIRKLELMNCEFLKFLPKSIGDMDTLCSLNLEGSNIEELPEEFGKLENLVELRMSNCTMLKRLPESFGDLKSLHHLYMKETLVSELPESFGNLSKLMVLEMLKNPLFRISESNAPGTSEEPRFVEVPNSFSNLTSLEELDARSWRISGKIPDDLEKLSSLMKLNLGNNYFHSLPSSLVGLSNLQELSLRDCRELKRLPPLPCKLEHLNMANCFSLESVSDLSELTILEDLNLTNCGKVVDIPGLEHLM


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-205 SSF52058,LRR

LEKLVLERCNLLVKVPRSVGNLRKLLQLDLRRCSNLSEFLVDVSGLKCLEKLFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPDSIFRLQKLEKLSLMGCRSIQELPTCIGKLTSLEDLYLDDTALRNLPNSIGDLKNLQKLHLMRCTSLSKIPDSINELISLKKLFITGSAVEELPLKPSSLPSLTDFSAGGCKFLKQVP

HMMPanther: PTHR23155:SF303
1-476 PTHR23155:SF303

LEKLVLERCNLLVKVPRSVGNLRKLLQLDLRRCSNLSEFLVDVSGLKCLEKLFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPDSIFRLQKLEKLSLMGCRSIQELPTCIGKLTSLEDLYLDDTALRNLPNSIGDLKNLQKLHLMRCTSLSKIPDSINELISLKKLFITGSAVEELPLKPSSLPSLTDFSAGGCKFLKQVPSSIGGLNSLLQLQLNTTLIEALPKEIGALHFIRKLELMNCEFLKFLPKSIGDMDTLCSLNLEGSNIEELPEEFGKLENLVELRMSNCTMLKRLPESFGDLKSLHHLYMKETLVSELPESFGNLSKLMVLEMLKNPLFRISESNAPGTSEEPRFVEVPNSFSNLTSLEELDARSWRISGKIPDDLEKLSSLMKLNLGNNYFHSLPSSLVGLSNLQELSLRDCRELKRLPPLPCKLEHLNMANCFSLESVSDLSELTILEDLNLTNCGKVVDI

HMMPanther: PTHR23155
1-476 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LEKLVLERCNLLVKVPRSVGNLRKLLQLDLRRCSNLSEFLVDVSGLKCLEKLFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPDSIFRLQKLEKLSLMGCRSIQELPTCIGKLTSLEDLYLDDTALRNLPNSIGDLKNLQKLHLMRCTSLSKIPDSINELISLKKLFITGSAVEELPLKPSSLPSLTDFSAGGCKFLKQVPSSIGGLNSLLQLQLNTTLIEALPKEIGALHFIRKLELMNCEFLKFLPKSIGDMDTLCSLNLEGSNIEELPEEFGKLENLVELRMSNCTMLKRLPESFGDLKSLHHLYMKETLVSELPESFGNLSKLMVLEMLKNPLFRISESNAPGTSEEPRFVEVPNSFSNLTSLEELDARSWRISGKIPDDLEKLSSLMKLNLGNNYFHSLPSSLVGLSNLQELSLRDCRELKRLPPLPCKLEHLNMANCFSLESVSDLSELTILEDLNLTNCGKVVDI

Gene3D: G3DSA:3.80.10.10
1-166 G3DSA:3.80.10.10

LEKLVLERCNLLVKVPRSVGNLRKLLQLDLRRCSNLSEFLVDVSGLKCLEKLFLSGCSNLSVLPENIGSMPCLKELLLDGTAISNLPDSIFRLQKLEKLSLMGCRSIQELPTCIGKLTSLEDLYLDDTALRNLPNSIGDLKNLQKLHLMRCTSLSKIPDSINELIS

HMMPfam: PF00560
IPR001611
49-69 LRR_1
Leucine-rich repeat

LEKLFLSGCSNLSVLPENIGS

HMMPfam: PF13855
73-129 LRR_8,Leucine rich repeat

LKELLLDGTAISNLPDSIFRLQKLEKLSLMGCRSIQELPTCIGKLTSLEDLYLDDTA

HMMPfam: PF13504
142-158 LRR_7,Leucine rich repeat

NLQKLHLMRCTSLSKIP

Gene3D: G3DSA:3.80.10.10
167-348 G3DSA:3.80.10.10

LKKLFITGSAVEELPLKPSSLPSLTDFSAGGCKFLKQVPSSIGGLNSLLQLQLNTTLIEALPKEIGALHFIRKLELMNCEFLKFLPKSIGDMDTLCSLNLEGSNIEELPEEFGKLENLVELRMSNCTMLKRLPESFGDLKSLHHLYMKETLVSELPESFGNLSKLMVLEMLKNPLFRISESN

superfamily: SSF52047
203-482 SSF52047,LRR

QVPSSIGGLNSLLQLQLNTTLIEALPKEIGALHFIRKLELMNCEFLKFLPKSIGDMDTLCSLNLEGSNIEELPEEFGKLENLVELRMSNCTMLKRLPESFGDLKSLHHLYMKETLVSELPESFGNLSKLMVLEMLKNPLFRISESNAPGTSEEPRFVEVPNSFSNLTSLEELDARSWRISGKIPDDLEKLSSLMKLNLGNNYFHSLPSSLVGLSNLQELSLRDCRELKRLPPLPCKLEHLNMANCFSLESVSDLSELTILEDLNLTNCGKVVDIPGLEHL

HMMPfam: PF00560
IPR001611
283-305 LRR_1
Leucine-rich repeat

NLVELRMSNCTMLKRLPESFGDL

Gene3D: G3DSA:3.80.10.10
360-471 G3DSA:3.80.10.10

EVPNSFSNLTSLEELDARSWRISGKIPDDLEKLSSLMKLNLGNNYFHSLPSSLVGLSNLQELSLRDCRELKRLPPLPCKLEHLNMANCFSLESVSDLSELTILEDLNLTNCG

HMMPfam: PF13504
393-409 LRR_7,Leucine rich repeat

SSLMKLNLGNNYFHSLP

HMMPfam: PF13504
416-433 LRR_7,Leucine rich repeat

SNLQELSLRDCRELKRLP


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox