PRGDB00044671 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4757407 (AB026651)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MQD19.

DNA Sequence

ATGCTGGGCTGGCTTGTAATACCCTGGAATCAAATCTTCACTGCTGCATGTGGCTGCTTTCTAAGCGATAGAAACTACATTCACATGATGGAGTCAAATCTCGATGCTCTGCAGAAAACTATGGAAGAACTTAAGAATGGACGAGATGACCTGTTAGGAAGAGTTTCCATAGAAGAAGATAAAGGTTTGCAACGACTTGCTCAAGTCAATGGATGGCTTTCCAGGGTACAAATTGTTGAATCCGAATTCAAGGATCTGCTTGAGGCTATGTCAATCGAAACCGGAAGATTGTGTTTGTTGGGATATTGCTCTGAGGATTGCATATCAAGCTACAATTATGGTGAAAAGGTATCGAAGATGTTGGAAGAAGTTAAAGAACTTCTATCTAAAAAAGATTTTAGAATGGTCGCGCAGGAAATTATACATAAGGTGGAGAAGAAGCTTATCCAAACCACAGTTGGTTTGGATAAACTGGTGGAAATGGCGTGGAGCAGCCTGATGAACGATGAAATAGGAACCTTGGGACTTTATGGTATGGGGGGAGTAGGAAAAACCACCCTCTTAGAAAGTCTCAACAACAAATTTGTTGAACTGGAGAGTGAATTTGATGTAGTGATATGGGTTGTGGTATCTAAAGACTTTCAGTTCGAGGGCATTCAAGATCAGATTCTGGGAAGATTACGTTCTGACAAGGAATGGGAAAGAGAAACAGAAAGTAAGAAAGCCTCTCTCATATACAATAACCTTGAGAGAAAGAAATTTGTGTTGTTGTTGGATGATCTCTGGAGTGAAGTAGATATGACTAAGATAGGAGTTCCACCTCCAACTCGAGAAAATGGATCGAAGATTGTTTTCACCACTCGTTCAACGGAAGTTTGCAAGCACATGAAAGCTGACAAGCAGATAAAAGTTGCTTGTTTGTCCCCAGATGAAGCGTGGGAATTGTTTCGACTTACTGTTGGAGATATCATATTAAGGAGCCATCAAGATATTCCCGCACTTGCAAGAATAGTTGCTGCAAAATGCCATGGCTTGCCACTTGCACTCAATGTCATTGGCAAAGCCATGTCATGTAAAGAAACTATACAAGAATGGTCTCATGCGATTAATGTTCTGAATTCGGCTGGCCACGAGTTTCCAGGTATGGAAGAAAGAATTCTTCCCATTTTGAAGTTCAGTTATGATAGCTTGAAGAATGGTGAAATCAAATTGTGCTTCCTATATTGTTCTCTGTTTCCTGAAGATTCTGAAATACCGAAGGAGAAGTGGATAGAATACTGGATATGCGAAGGATTTATAAATCCAAACAGATATGAAGATGGAGGTACCAACCATGGTTATGATATAATTGGCTTGTTAGTTCGTGCACATTTGTTGATTGAATGTGAACTCACAGACAACGTTAAAATGCATGATGTGATACGTGAGATGGCTCTTTGGATAAATTCTGACTTCGGAAAACAACAAGAAACAATCTGTGTGAAATCTGGTGCTCATGTACGTATGATACCGAATGACATCAATTGGGAGATTGTGAGAACGATGTCTTTTACTTGTACTCAGATTAAGAAGATATCTTGTCGTTCCAAATGCCCCAACCTTTCAACCCTTTTAATCCTAGATAACAGGTTGTTGGTGAAAATTTCAAATAGATTCTTTCGGTTTATGCCAAAACTTGTGGTCTTGGATCTTTCTGCAAACCTCGATCTTATTAAATTGCCGGAAGAAATTTCTAACCTAGGTTCCCTGCAATATCTCAATATATCACTCACAGGGATAAAATCGCTACCAGTTGGTCTGAAGAAGTTGAGGAAACTAATCTACTTGAATCTGGAGTTCACTGGTGTACATGGGAGTCTTGTTGGGATAGCAGCAACCTTACCAAATCTGCAAGTGTTGAAATTCTTTTATTCCTGTGTTTATGTTGATGACATATTAATGAAGGAATTACAAGACTTGGAGCACTTGAAGATTTTAACAGCAAACGTAAAGGATGTCACGATTTTGGAAAGGATACAAGGAGATGACAGATTGGCGAGTAGTATTCGAAGTTTATGTCTAGAAGATATGTCAACACCTCGTGTAATATTAAGCACGATAGCTCTGGGAGGTCTTCAACAACTTGCAATTCTGATGTGCAACATATCCGAGATAAGGATAGATTGGGAAAGCAAAGAAAGAAGGGAGCTTTCACCAACGGAGATTCTTCCATCTACAGGTTCTCCAGGCTTCAAGCAACTCTCCACTGTTTATATAAACCAGTTGGAAGGGCAAAGGGATTTGTCATGGCTGTTATATGCTCAAAATCTAAAGAAACTAGAAGTGTGCTGGTCACCACAAATAGAAGAAATAATAAATAAGGAGAAAGGAATGAATATTACCAAACTGCATCGAGATATTGTTGTTCCATTTGGGAACCTGGAAGACCTTGCGCTACGTCAAATGGCGGACCTCACGGAAATTTGCTGGAATTATCGGACTCTCCCTAACCTTAGAAAATCATATATCAACGATTGTCCAAAGCTACCTGAAGATATTTTCGTGCCTCTGCTTCCTGAAAAGAGTCCTTCACGTTTTTTTTTCTTTTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MLGWLVIPWNQIFTAACGCFLSDRNYIHMMESNLDALQKTMEELKNGRDDLLGRVSIEEDKGLQRLAQVNGWLSRVQIVESEFKDLLEAMSIETGRLCLLGYCSEDCISSYNYGEKVSKMLEEVKELLSKKDFRMVAQEIIHKVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSHAINVLNSAGHEFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDSEIPKEKWIEYWICEGFINPNRYEDGGTNHGYDIIGLLVRAHLLIECELTDNVKMHDVIREMALWINSDFGKQQETICVKSGAHVRMIPNDINWEIVRTMSFTCTQIKKISCRSKCPNLSTLLILDNRLLVKISNRFFRFMPKLVVLDLSANLDLIKLPEEISNLGSLQYLNISLTGIKSLPVGLKKLRKLIYLNLEFTGVHGSLVGIAATLPNLQVLKFFYSCVYVDDILMKELQDLEHLKILTANVKDVTILERIQGDDRLASSIRSLCLEDMSTPRVILSTIALGGLQQLAILMCNISEIRIDWESKERRELSPTEILPSTGSPGFKQLSTVYINQLEGQRDLSWLLYAQNLKKLEVCWSPQIEEIINKEKGMNITKLHRDIVVPFGNLEDLALRQMADLTEICWNYRTLPNLRKSYINDCPKLPEDIFVPLLPEKSPSRFFFF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
5-846 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LVIPWNQIFTAACGCFLSDRNYIHMMESNLDALQKTMEELKNGRDDLLGRVSIEEDKGLQRLAQVNGWLSRVQIVESEFKDLLEAMSIETGRLCLLGYCSEDCISSYNYGEKVSKMLEEVKELLSKKDFRMVAQEIIHKVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSHAINVLNSAGHEFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDSEIPKEKWIEYWICEGFINPNRYEDGGTNHGYDIIGLLVRAHLLIECELTDNVKMHDVIREMALWINSDFGKQQETICVKSGAHVRMIPNDINWEIVRTMSFTCTQIKKISCRSKCPNLSTLLILDNRLLVKISNRFFRFMPKLVVLDLSANLDLIKLPEEISNLGSLQYLNISLTGIKSLPVGLKKLRKLIYLNLEFTGVHGSLVGIAATLPNLQVLKFFYSCVYVDDILMKELQDLEHLKILTANVKDVTILERIQGDDRLASSIRSLCLEDMSTPRVILSTIALGGLQQLAILMCNISEIRIDWESKERRELSPTEILPSTGSPGFKQLSTVYINQLEGQRDLSWLLYAQNLKKLEVCWSPQIEEIINKEKGMNITKLHRDIVVPFGNLEDLALRQMADLTEICWNYRTLPNLRKSYINDCPKLPEDI

HMMPanther: PTHR23155:SF115
5-846 PTHR23155:SF115,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LVIPWNQIFTAACGCFLSDRNYIHMMESNLDALQKTMEELKNGRDDLLGRVSIEEDKGLQRLAQVNGWLSRVQIVESEFKDLLEAMSIETGRLCLLGYCSEDCISSYNYGEKVSKMLEEVKELLSKKDFRMVAQEIIHKVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSHAINVLNSAGHEFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDSEIPKEKWIEYWICEGFINPNRYEDGGTNHGYDIIGLLVRAHLLIECELTDNVKMHDVIREMALWINSDFGKQQETICVKSGAHVRMIPNDINWEIVRTMSFTCTQIKKISCRSKCPNLSTLLILDNRLLVKISNRFFRFMPKLVVLDLSANLDLIKLPEEISNLGSLQYLNISLTGIKSLPVGLKKLRKLIYLNLEFTGVHGSLVGIAATLPNLQVLKFFYSCVYVDDILMKELQDLEHLKILTANVKDVTILERIQGDDRLASSIRSLCLEDMSTPRVILSTIALGGLQQLAILMCNISEIRIDWESKERRELSPTEILPSTGSPGFKQLSTVYINQLEGQRDLSWLLYAQNLKKLEVCWSPQIEEIINKEKGMNITKLHRDIVVPFGNLEDLALRQMADLTEICWNYRTLPNLRKSYINDCPKLPEDI

superfamily: SSF52540
134-367 SSF52540

RMVAQEIIHKVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSH

Gene3D: G3DSA:3.40.50.300
138-261 G3DSA:3.40.50.300

QEIIHKVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDL

HMMPfam: PF00931
IPR002182
157-436 NB-ARC,NBS
NB-ARC

KLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSHAINVLNSAGHEFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDSEIPKEKWIEYWICEGFINPN

FPrintScan: PR00364
IPR000767
173-188 DISEASERSIST
Disease resistance protein

TLGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
248-262 DISEASERSIST
Disease resistance protein

NLERKKFVLLLDDLW

FPrintScan: PR00364
IPR000767
342-356 DISEASERSIST
Disease resistance protein

CHGLPLALNVIGKAM

superfamily: SSF52058
484-842 SSF52058,LRR

DFGKQQETICVKSGAHVRMIPNDINWEIVRTMSFTCTQIKKISCRSKCPNLSTLLILDNRLLVKISNRFFRFMPKLVVLDLSANLDLIKLPEEISNLGSLQYLNISLTGIKSLPVGLKKLRKLIYLNLEFTGVHGSLVGIAATLPNLQVLKFFYSCVYVDDILMKELQDLEHLKILTANVKDVTILERIQGDDRLASSIRSLCLEDMSTPRVILSTIALGGLQQLAILMCNISEIRIDWESKERRELSPTEILPSTGSPGFKQLSTVYINQLEGQRDLSWLLYAQNLKKLEVCWSPQIEEIINKEKGMNITKLHRDIVVPFGNLEDLALRQMADLTEICWNYRTLPNLRKSYINDCPKL

Gene3D: G3DSA:3.80.10.10
510-653 G3DSA:3.80.10.10

EIVRTMSFTCTQIKKISCRSKCPNLSTLLILDNRLLVKISNRFFRFMPKLVVLDLSANLDLIKLPEEISNLGSLQYLNISLTGIKSLPVGLKKLRKLIYLNLEFTGVHGSLVGIAATLPNLQVLKFFYSCVYVDDILMKELQDL

FPrintScan: PR00364
IPR000767
554-570 DISEASERSIST
Disease resistance protein

RFMPKLVVLDLSANLDL

Gene3D: G3DSA:3.80.10.10
768-840 G3DSA:3.80.10.10

QNLKKLEVCWSPQIEEIINKEKGMNITKLHRDIVVPFGNLEDLALRQMADLTEICWNYRTLPNLRKSYINDCP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox