PRGDB00044672 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4757407 (AB026651)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MQD19.

DNA Sequence

ATGGTGGACTGGCTTTCACTATTACCCTGGAATAAAATCTTCACTGCTGCATGTGGCTGCTTTTTAAGCGATAGCAACTACATTCACTTGATGGAGTCAAATCTCGATGCTCTGCAGAAAACTATGGAAGAACTTAAGAATGGGCGAGATGATCTGTTAGCAAGAGTTTCCATAGAAGAAGATAAAGGTTTGCAACGGCTTGCTCTAGTCAACGGATGGCTTTCAAGGGTACAAATTGTTGAATCCGAATTCAAGGATCTGCTTGAGGCTATGTCAATCGAAACTGGAAGATTGTGTCTATTTGGATATTGTTCTGAGGATTGCATATCAAGCTACAATTATGGTGGAAAGGTAATGAAGAATTTGGAAGAAGTTAAAGAACTTCTATCTAAAAAGAATTTTGAAGTGGTGGCGCAGAAAATCATACCTAAGGCAGAGAAGAAGCATATACAAACCACAGTTGGTTTGGATACAATGGTTGGAATAGCATGGGAAAGCCTCATAGACGATGAAATAAGAACCTTGGGTCTTTATGGTATGGGGGGAATAGGAAAAACCACCCTCTTAGAAAGTCTCAACAACAAATTTGTTGAACTGGAGAGTGAATTTGATGTAGTGATATGGGTTGTGGTATCTAAAGACTTTCAGTTGGAGGGCATTCAAGATCAGATTCTGGGGAGATTACGTCCTGACAAGGAATGGGAAAGAGAAACAGAAAGTAAGAAAGCCTCTCTCATAAACAATAACCTTAAGAGAAAGAAATTTGTGTTGTTGTTGGATGATCTCTGGAGCGAAGTAGATCTAATTAAGATAGGAGTTCCACCTCCAAGTCGAGAAAATGGATCGAAGATAGTTTTCACCACACGTTCAAAGGAAGTTTGCAAGCACATGAAAGCTGACAAGCAGATAAAAGTTGACTGTTTGTCACCAGATGAAGCGTGGGAATTGTTTCGACTCACTGTTGGAGATATCATATTAAGGAGCCATCAAGATATTCCCGCACTTGCAAGAATAGTTGCTGCAAAATGCCATGGCTTGCCACTTGCACTCAATGTCATTGGCAAAGCCATGGTATGTAAAGAGACTGTACAAGAATGGCGTCATGCGATTAATGTTCTGAATTCGCCTGGCCACAAGTTTCCAGGTATGGAAGAAAGAATTCTTCCCATTTTGAAGTTCAGTTATGATAGCTTAAAGAATGGTGAAATCAAATTGTGCTTCCTATATTGTTCTCTGTTTCCTGAAGATTTTGAAATAGAGAAGGATAAGTTGATAGAATATTGGATTTGCGAAGGATATATAAATCCGAACAGATATGAAGATGGAGGTACTAACCAAGGTTATGATATAATTGGCTTGTTAGTTCGTGCACATTTGTTGATTGAATGTGAACTCACAGACAAAGTTAAAATGCATGATGTGATACGTGAGATGGCTCTTTGGATAAATTCTGACTTCGGAAATCAGCAAGAAACAATTTGTGTGAAATCTGGTGCTCATGTACGTCTGATACCAAATGACATCAGTTGGGAGATTGTGAGACAGATGTCTTTAATTAGTACTCAGGTTGAGAAGATAGCTTGCAGTCCCAACTGCCCCAACCTTTCAACCCTATTACTCCCATATAACAAGTTGGTGGATATTTCAGTTGGATTCTTTCTGTTTATGCCAAAACTTGTGGTCTTGGATCTTTCTACAAACTGGAGTCTTATTGAATTGCCGGAAGAAATTTCTAACCTAGGCTCCCTGCAATATCTCAATTTATCACTCACAGGGATAAAATCGCTACCAGTTGGTCTGAAGAAGTTGAGGAAACTAATCTACTTGAATCTGGAGTTCACTAATGTACTTGAGAGTCTTGTTGGAATAGCAACAACTTTACCAAATCTGCAAGTGTTGAAATTATTTTATTCTCTTTTTTGTGTTGATGACATAATTATGGAGGAACTACAGCGCTTGAAGCACTTGAAGATTTTAACAGCAACCATAGAGGATGCCATGATTTTGGAAAGGGTACAAGGAGTTGACCGATTGGCGAGTAGTATTCGAGGTTTATGTCTAAGAAACATGTCAGCACCTCGTGTAATATTAAACTCGGTAGCTCTGGGAGGTCTTCAACAACTTGGAATTGTGAGCTGCAACATATCTGAGATAGAGATAGATTGGTTAAGCAAAGAAAGAAGGGATCATCGATCTACAAGTTCTCCAGGCTTCAAGCAACTCGCCAGTATTACTGTAATCGGTTTGGTAGGGCCAAGGGATTTGTCATGGCTGTTATTTGCTCAAAATCTGAAGGATATACAAGTGCAATATTCACCAACAATAGAAGAAATAATAAATAAGCAGAAAGGAATGAGTATTACCAAAGTGCATCGAGATATTGTTGTTCCCTTTGGGAAGCTGGAATCCCTTCATCTATATCAATTGGCTGAGCTTACAGAAATCTGCTGGAATTATCAGACTCTTCCTAACCTTAGAGAATCCTATGTCAATTATTGTCCAAAGCTACTTGAAGATATAGCTAATTTTCCCAAGCTGAAAGGGTGA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MVDWLSLLPWNKIFTAACGCFLSDSNYIHLMESNLDALQKTMEELKNGRDDLLARVSIEEDKGLQRLALVNGWLSRVQIVESEFKDLLEAMSIETGRLCLFGYCSEDCISSYNYGGKVMKNLEEVKELLSKKNFEVVAQKIIPKAEKKHIQTTVGLDTMVGIAWESLIDDEIRTLGLYGMGGIGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRPDKEWERETESKKASLINNNLKRKKFVLLLDDLWSEVDLIKIGVPPPSRENGSKIVFTTRSKEVCKHMKADKQIKVDCLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMVCKETVQEWRHAINVLNSPGHKFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDFEIEKDKLIEYWICEGYINPNRYEDGGTNQGYDIIGLLVRAHLLIECELTDKVKMHDVIREMALWINSDFGNQQETICVKSGAHVRLIPNDISWEIVRQMSLISTQVEKIACSPNCPNLSTLLLPYNKLVDISVGFFLFMPKLVVLDLSTNWSLIELPEEISNLGSLQYLNLSLTGIKSLPVGLKKLRKLIYLNLEFTNVLESLVGIATTLPNLQVLKLFYSLFCVDDIIMEELQRLKHLKILTATIEDAMILERVQGVDRLASSIRGLCLRNMSAPRVILNSVALGGLQQLGIVSCNISEIEIDWLSKERRDHRSTSSPGFKQLASITVIGLVGPRDLSWLLFAQNLKDIQVQYSPTIEEIINKQKGMSITKVHRDIVVPFGKLESLHLYQLAELTEICWNYQTLPNLRESYVNYCPKLLEDIANFPKLKG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF114
6-847 PTHR23155:SF114,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

SLLPWNKIFTAACGCFLSDSNYIHLMESNLDALQKTMEELKNGRDDLLARVSIEEDKGLQRLALVNGWLSRVQIVESEFKDLLEAMSIETGRLCLFGYCSEDCISSYNYGGKVMKNLEEVKELLSKKNFEVVAQKIIPKAEKKHIQTTVGLDTMVGIAWESLIDDEIRTLGLYGMGGIGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRPDKEWERETESKKASLINNNLKRKKFVLLLDDLWSEVDLIKIGVPPPSRENGSKIVFTTRSKEVCKHMKADKQIKVDCLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMVCKETVQEWRHAINVLNSPGHKFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDFEIEKDKLIEYWICEGYINPNRYEDGGTNQGYDIIGLLVRAHLLIECELTDKVKMHDVIREMALWINSDFGNQQETICVKSGAHVRLIPNDISWEIVRQMSLISTQVEKIACSPNCPNLSTLLLPYNKLVDISVGFFLFMPKLVVLDLSTNWSLIELPEEISNLGSLQYLNLSLTGIKSLPVGLKKLRKLIYLNLEFTNVLESLVGIATTLPNLQVLKLFYSLFCVDDIIMEELQRLKHLKILTATIEDAMILERVQGVDRLASSIRGLCLRNMSAPRVILNSVALGGLQQLGIVSCNISEIEIDWLSKERRDHRSTSSPGFKQLASITVIGLVGPRDLSWLLFAQNLKDIQVQYSPTIEEIINKQKGMSITKVHRDIVVPFGKLESLHLYQLAELTEICWNYQTLPNLRESYVNYCPKLLEDIANFPKLK

HMMPanther: PTHR23155
6-847 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SLLPWNKIFTAACGCFLSDSNYIHLMESNLDALQKTMEELKNGRDDLLARVSIEEDKGLQRLALVNGWLSRVQIVESEFKDLLEAMSIETGRLCLFGYCSEDCISSYNYGGKVMKNLEEVKELLSKKNFEVVAQKIIPKAEKKHIQTTVGLDTMVGIAWESLIDDEIRTLGLYGMGGIGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRPDKEWERETESKKASLINNNLKRKKFVLLLDDLWSEVDLIKIGVPPPSRENGSKIVFTTRSKEVCKHMKADKQIKVDCLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMVCKETVQEWRHAINVLNSPGHKFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDFEIEKDKLIEYWICEGYINPNRYEDGGTNQGYDIIGLLVRAHLLIECELTDKVKMHDVIREMALWINSDFGNQQETICVKSGAHVRLIPNDISWEIVRQMSLISTQVEKIACSPNCPNLSTLLLPYNKLVDISVGFFLFMPKLVVLDLSTNWSLIELPEEISNLGSLQYLNLSLTGIKSLPVGLKKLRKLIYLNLEFTNVLESLVGIATTLPNLQVLKLFYSLFCVDDIIMEELQRLKHLKILTATIEDAMILERVQGVDRLASSIRGLCLRNMSAPRVILNSVALGGLQQLGIVSCNISEIEIDWLSKERRDHRSTSSPGFKQLASITVIGLVGPRDLSWLLFAQNLKDIQVQYSPTIEEIINKQKGMSITKVHRDIVVPFGKLESLHLYQLAELTEICWNYQTLPNLRESYVNYCPKLLEDIANFPKLK

superfamily: SSF52540
136-368 SSF52540

VVAQKIIPKAEKKHIQTTVGLDTMVGIAWESLIDDEIRTLGLYGMGGIGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRPDKEWERETESKKASLINNNLKRKKFVLLLDDLWSEVDLIKIGVPPPSRENGSKIVFTTRSKEVCKHMKADKQIKVDCLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMVCKETVQEWRH

HMMPfam: PF00931
IPR002182
158-437 NB-ARC,NBS
NB-ARC

TMVGIAWESLIDDEIRTLGLYGMGGIGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRPDKEWERETESKKASLINNNLKRKKFVLLLDDLWSEVDLIKIGVPPPSRENGSKIVFTTRSKEVCKHMKADKQIKVDCLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMVCKETVQEWRHAINVLNSPGHKFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDFEIEKDKLIEYWICEGYINPN

Gene3D: G3DSA:3.40.50.300
168-292 G3DSA:3.40.50.300

IDDEIRTLGLYGMGGIGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQLEGIQDQILGRLRPDKEWERETESKKASLINNNLKRKKFVLLLDDLWSEVDLIKIGVPPPSRENGSKIVFTTRSKE

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

TLGLYGMGGIGKTTLL

FPrintScan: PR00364
IPR000767
249-263 DISEASERSIST
Disease resistance protein

NLKRKKFVLLLDDLW

FPrintScan: PR00364
IPR000767
343-357 DISEASERSIST
Disease resistance protein

CHGLPLALNVIGKAM

superfamily: SSF52058
485-836 SSF52058,LRR

DFGNQQETICVKSGAHVRLIPNDISWEIVRQMSLISTQVEKIACSPNCPNLSTLLLPYNKLVDISVGFFLFMPKLVVLDLSTNWSLIELPEEISNLGSLQYLNLSLTGIKSLPVGLKKLRKLIYLNLEFTNVLESLVGIATTLPNLQVLKLFYSLFCVDDIIMEELQRLKHLKILTATIEDAMILERVQGVDRLASSIRGLCLRNMSAPRVILNSVALGGLQQLGIVSCNISEIEIDWLSKERRDHRSTSSPGFKQLASITVIGLVGPRDLSWLLFAQNLKDIQVQYSPTIEEIINKQKGMSITKVHRDIVVPFGKLESLHLYQLAELTEICWNYQTLPNLRESYVNYCPKL

Gene3D: G3DSA:3.80.10.10
511-665 G3DSA:3.80.10.10

EIVRQMSLISTQVEKIACSPNCPNLSTLLLPYNKLVDISVGFFLFMPKLVVLDLSTNWSLIELPEEISNLGSLQYLNLSLTGIKSLPVGLKKLRKLIYLNLEFTNVLESLVGIATTLPNLQVLKLFYSLFCVDDIIMEELQRLKHLKILTATIED

HMMPfam: PF13855
533-589 LRR_8,Leucine rich repeat

PNLSTLLLPYNKLVDISVGFFLFMPKLVVLDLSTNWSLIELPEEISNLGSLQYLNLS

FPrintScan: PR00364
IPR000767
554-570 DISEASERSIST
Disease resistance protein

LFMPKLVVLDLSTNWSL

Gene3D: G3DSA:3.80.10.10
789-835 G3DSA:3.80.10.10

KVHRDIVVPFGKLESLHLYQLAELTEICWNYQTLPNLRESYVNYCPK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox