PRGDB00044673 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3241916 (AB015468)
Gene Class CNL
Domain Type LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K15N18.

DNA Sequence

ATGGCTGAAGGATTTGTGTCGTTTGGGCTTGAGAAGCTTTGGGATCTCCTGAGTCGAGAATCAGAGCGATTGCAGGGAATTGATGAGCAACTTGATGGACTAAAGCGTCAGCTGAGAAGTTTACAGTCGCTGTTGAAAGATGCAGATGCCAAGAAACATGGAAGTGATAGGGTGAGGAACTTCTTGGAAGATGTCAAAGACCTTGTTTTTGATGCTGAGGATATAATTGAATCCTATGTTCTGAACAAACTTAGAGGAGAAGGAAAAGGGGTCAAGAAGCATGTGAGACGACTTGCTCGCTTCTTAACGGATCGCCACAAAGTTGCTTCAGATATCGAGGGTATAACTAAGAGGATCTCTGATGTGATTGGGGAGATGCAGAGTTTTGGGATACAACAAATCATTGATGGTGTTCGTTCGCTGTCTCTTCAGGAAAGACAAAGGGTGCAGAGGGAGATCCGACAAACGTATCCTGACAGTTCTGAAAGCGATCTTGTCGGGGTGGAGCAGAGTGTTGAAGAATTGGTTGGTCATTTGGTGGAGAATGATATTTATCAAGTGGTTTCTATAGCTGGGATGGGCGGTATTGGTAAAACCACTCTGGCTAGACAAGTCTTTCATCATGATTTAGTCCGGCGTCACTTTGATGGATTCGCATGGGTCTGTGTTTCGCAACAATTTACACTGAAACATGTTTGGCAGAGGATCTTGCAAGAACTTCAGCCACATGATGGGAATATTTTACAGATGGACGAATCTGCACTTCAGCCTAAACTCTTTCAATTGTTAGAGACCGGTAGATATTTACTTGTCCTCGATGATGTATGGAAAAAAGAAGACTGGGATCGAATAAAAGCAGTGTTTCCACGGAAAAGAGGTTGGAAGATGCTGCTTACTTCTCGAAATGAAGGTGTTGGGATACATGCTGATCCAACATGTTTAACTTTTAGAGCAAGCATCCTTAACCCTGAAGAAAGTTGGAAGCTCTGTGAGAGAATAGTATTCCCTAGGAGAGATGAAACTGAAGTAAGGCTTGATGAAGAAATGGAAGCCATGGGAAAGGAAATGGTCACACATTGTGGAGGACTACCATTAGCTGTTAAAGCGTTGGGAGGCTTGTTAGCTAATAAACATACAGTTCCTGAGTGGAAAAGAGTTTCTGACAATATTGGATCTCAAATAGTAGGAGGATCGTGCTTAGATGACAACAGTCTCAATTCGGTTAACCGAATATTGTCTCTGAGTTATGAAGATTTGCCAACGCATTTAAAGCATCGCTTCCTTTACCTAGCCCATTTCCCTGAAGATTCCAAGATATACACGCAGGATTTGTTCAATTACTGGGCTGCAGAAGGGATTTACGATGGATCAACCATCCAAGATAGTGGAGAATACTACCTAGAAGAGCTAGTGAGGAGAAATTTGGTTATTGCAGACAACAGGTATTTGAGTTTGGAATTTAATTTTTGTCAAATGCACGACATGATGAGAGAAGTATGTTTATCTAAAGCCAAAGAAGAGAACTTCTTACAAATTATCAAAGACCCTACTTCCACCTCTACCATCAATGCTCAATCTCCTAGTAGATCTCGCAGATTCAGCATACATAGTGGTAAAGCCTTTCATATATTGGGACACAGAAACAATCCAAAGGTGAGATCTCTTATAGTTTCGAGATTCGAGGAAGACTTTTGGATACGATCAGCTTCAGTCTTCCACAACTTAACATTGCTCAGGGTGTTGGATCTTTCTAGGGTAAAGTTTGAAGGAGGGAAGTTACCTTCTAGCATTGGAGGGCTCATCCACTTGAGATACTTGAGCTTATACGGAGCTGTGGTATCTCATCTACCTTCTACTATGCGGAACTTAAAGCTTCTGCTCTTTTTGAACTTACGTGTTGATAACAAGGAACCGATTCACGTGCCAAATGTTTTGAAAGAGATGCTAGAGTTGAGGTACCTTTCCCTACCTCAGGAAATGGATGATAAAACCAAGTTGGAATTGGGTGATCTAGTGAACCTGGAGTACTTGTGGTATTTCTCAACGCAACACAGTAGTGTGACAGACCTCCTCCGTATGACTAAGCTCCGGAATCTCGGTGTATCTTTGAGCGAAAGGTGCAATTTTGAAACTCTATCGTCATCTCTCCGTGAATTGCGAAACCTCGAAATGCTTAATGTCCTTTTTTCGCCCGAAATCGTTATGGTTGATCATATGGGAGAGTTTGTTCTGGATCATTTTATTCATCTAAAACAGTTGGGATTGGCAGTACGTATGTCAAAGATTCCTGATCAACATCAATTCCCTCCCCACCTTGCCCACATACATCTAGTGCATTGCGTCATGAAAGAGGATCCAATGCCAATTCTAGAAAAGTTGCTTCATTTGAAGTCGGTTGCATTAAGTTATGGTGCTTTCATCGGGCGGAGAGTGGTGTGCTCAAAAGGCGGATTTCCTCAATTATGTGCCCTAGGAATATCTGGAGAATCAGAATTGGAAGAGTGGATAGTAGAAGAAGGGTCGATGCCATGTCTTCGTACTTTGACTATACATGATTGCGAAAAGTTGAAGGAACTTCCTGATGGACTCAAGTACATAACATCCTTAAAGGAGCTAAAGATTAGAGAAATGAAGAGGGAGTGGAAGGAGAAACTGGTACCAGGTGGAGAAGATTACTACAAAGTCCAACACATTCCCGATGTTCAATTTATCAACTGTGACCTGTAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MAEGFVSFGLEKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKKHVRRLARFLTDRHKVASDIEGITKRISDVIGEMQSFGIQQIIDGVRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVEELVGHLVENDIYQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTLKHVWQRILQELQPHDGNILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVNRILSLSYEDLPTHLKHRFLYLAHFPEDSKIYTQDLFNYWAAEGIYDGSTIQDSGEYYLEELVRRNLVIADNRYLSLEFNFCQMHDMMREVCLSKAKEENFLQIIKDPTSTSTINAQSPSRSRRFSIHSGKAFHILGHRNNPKVRSLIVSRFEEDFWIRSASVFHNLTLLRVLDLSRVKFEGGKLPSSIGGLIHLRYLSLYGAVVSHLPSTMRNLKLLLFLNLRVDNKEPIHVPNVLKEMLELRYLSLPQEMDDKTKLELGDLVNLEYLWYFSTQHSSVTDLLRMTKLRNLGVSLSERCNFETLSSSLRELRNLEMLNVLFSPEIVMVDHMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLAHIHLVHCVMKEDPMPILEKLLHLKSVALSYGAFIGRRVVCSKGGFPQLCALGISGESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIREMKREWKEKLVPGGEDYYKVQHIPDVQFINCDL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
2-908 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEGFVSFGLEKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKKHVRRLARFLTDRHKVASDIEGITKRISDVIGEMQSFGIQQIIDGVRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVEELVGHLVENDIYQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTLKHVWQRILQELQPHDGNILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVNRILSLSYEDLPTHLKHRFLYLAHFPEDSKIYTQDLFNYWAAEGIYDGSTIQDSGEYYLEELVRRNLVIADNRYLSLEFNFCQMHDMMREVCLSKAKEENFLQIIKDPTSTSTINAQSPSRSRRFSIHSGKAFHILGHRNNPKVRSLIVSRFEEDFWIRSASVFHNLTLLRVLDLSRVKFEGGKLPSSIGGLIHLRYLSLYGAVVSHLPSTMRNLKLLLFLNLRVDNKEPIHVPNVLKEMLELRYLSLPQEMDDKTKLELGDLVNLEYLWYFSTQHSSVTDLLRMTKLRNLGVSLSERCNFETLSSSLRELRNLEMLNVLFSPEIVMVDHMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLAHIHLVHCVMKEDPMPILEKLLHLKSVALSYGAFIGRRVVCSKGGFPQLCALGISGESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIREMKREWKEKLVPGGEDYYKVQHIPDVQFINCDL

HMMPanther: PTHR23155:SF231
2-908 PTHR23155:SF231,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEGFVSFGLEKLWDLLSRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKKHVRRLARFLTDRHKVASDIEGITKRISDVIGEMQSFGIQQIIDGVRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVEELVGHLVENDIYQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTLKHVWQRILQELQPHDGNILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVNRILSLSYEDLPTHLKHRFLYLAHFPEDSKIYTQDLFNYWAAEGIYDGSTIQDSGEYYLEELVRRNLVIADNRYLSLEFNFCQMHDMMREVCLSKAKEENFLQIIKDPTSTSTINAQSPSRSRRFSIHSGKAFHILGHRNNPKVRSLIVSRFEEDFWIRSASVFHNLTLLRVLDLSRVKFEGGKLPSSIGGLIHLRYLSLYGAVVSHLPSTMRNLKLLLFLNLRVDNKEPIHVPNVLKEMLELRYLSLPQEMDDKTKLELGDLVNLEYLWYFSTQHSSVTDLLRMTKLRNLGVSLSERCNFETLSSSLRELRNLEMLNVLFSPEIVMVDHMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLAHIHLVHCVMKEDPMPILEKLLHLKSVALSYGAFIGRRVVCSKGGFPQLCALGISGESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIREMKREWKEKLVPGGEDYYKVQHIPDVQFINCDL

superfamily: SSF52540
148-396 SSF52540

RVQREIRQTYPDSSESDLVGVEQSVEELVGHLVENDIYQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTLKHVWQRILQELQPHDGNILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVSDNIGSQIVG

HMMPfam: PF00931
IPR002182
169-455 NB-ARC,NBS
NB-ARC

EQSVEELVGHLVENDIYQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTLKHVWQRILQELQPHDGNILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVSDNIGSQIVGGSCLDDNSLNSVNRILSLSYEDLPTHLKHRFLYLAHFPEDSKIYTQDLFNYWAAEGIYD

Gene3D: G3DSA:3.40.50.300
170-289 G3DSA:3.40.50.300

QSVEELVGHLVENDIYQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTLKHVWQRILQELQPHDGNILQMDESALQPKLFQLLETGRYLLVLDDVWKKEDWDRIKAVFP

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

VVSIAGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

LLETGRYLLVLDDVW

FPrintScan: PR00364
IPR000767
360-374 DISEASERSIST
Disease resistance protein

CGGLPLAVKALGGLL

superfamily: SSF52058
491-876 SSF52058,LRR

QMHDMMREVCLSKAKEENFLQIIKDPTSTSTINAQSPSRSRRFSIHSGKAFHILGHRNNPKVRSLIVSRFEEDFWIRSASVFHNLTLLRVLDLSRVKFEGGKLPSSIGGLIHLRYLSLYGAVVSHLPSTMRNLKLLLFLNLRVDNKEPIHVPNVLKEMLELRYLSLPQEMDDKTKLELGDLVNLEYLWYFSTQHSSVTDLLRMTKLRNLGVSLSERCNFETLSSSLRELRNLEMLNVLFSPEIVMVDHMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLAHIHLVHCVMKEDPMPILEKLLHLKSVALSYGAFIGRRVVCSKGGFPQLCALGISGESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIRE

Gene3D: G3DSA:3.80.10.10
548-686 G3DSA:3.80.10.10

NNPKVRSLIVSRFEEDFWIRSASVFHNLTLLRVLDLSRVKFEGGKLPSSIGGLIHLRYLSLYGAVVSHLPSTMRNLKLLLFLNLRVDNKEPIHVPNVLKEMLELRYLSLPQEMDDKTKLELGDLVNLEYLWYFSTQHSS

FPrintScan: PR00364
IPR000767
573-589 DISEASERSIST
Disease resistance protein

HNLTLLRVLDLSRVKFE

Gene3D: G3DSA:3.80.10.10
687-876 G3DSA:3.80.10.10

VTDLLRMTKLRNLGVSLSERCNFETLSSSLRELRNLEMLNVLFSPEIVMVDHMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLAHIHLVHCVMKEDPMPILEKLLHLKSVALSYGAFIGRRVVCSKGGFPQLCALGISGESELEEWIVEEGSMPCLRTLTIHDCEKLKELPDGLKYITSLKELKIRE


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox