PRGDB00044674 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 2924730 (AB011480)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MPI7.

DNA Sequence

AGTTGTGTTCCTGAGATTTTGTTCTGCACTAGCTTTCCTGGATGTGAAATGCCTTCATGGTTTAGTCACGATGCAATTGGATCTATGGTGGAGTTTGAATTACCTCCTCACTGGAATCACAATAGGCTTTCTGGGATAGCCCTATGTGTTGTTGTCTCATTCAAGAACTGTAAAAGTCATGCCAACTTGATAGTCAAGTTCTCTTGTGAGCAAAATAACGGAGAGGGCTCTTCCAGCAGCATTACTTGGAAGGTTGGAAGTTTGATTGAACAAGACAACCAAGAAGAAACAGTTGAATCAGATCATGTCTTTATTGGCTACACCAACTGCTTAGACTTCATAAAACTTGTTAAAGGCCAAGGTGGTCCTAAATGTGCTCCGACCAAAGCATCCCTTGAGTTTAGTGTGAGAACTGGTACTGGTGGGGAAGCTACGCTTGAAGTTTTGAAATCCGGTTTCAGTTTTGTGTTTGAACCTGAAGAGAACAGAGTTCCATCCCCAAGGAATGATGATGTAAAAGGTAAAGTAAAAATCAACAAAACTCCAAGTGCTAATGGTTGTTTCAAGGATCAAGCAAAAGGTAATGAATCTCCAAAGGGCCAGTGGCAGACTTACATTGAAAACTCTAGCACTAACATCCCAAGTGAAGCTCATTCTTCCCAAAAAACTGGTTTTGGTTCCACTCTTTTGTGTTAAGATGCACCAAAATTAAAATGGGTAAACTTAAATCACTCAAAGAAGTTGAACACTTTGGCAGGGTTAGGAAAAGCTCAAAATCTTCAAGAGCTAAATCTTGAAGGTTGCACGGCATTGAAAGAGATGCATGTGGATATGGAAAATATGAAGTTTCTTGTTTTCTTGAACCTGAGAGGATGCACAAGTCTCAAGTCTCTTCCAGAGATTCAGTTGATCTCTTTGAAAACTCTCATCCTCAGTGGCTGCTCAAAATTTAAAACCTTTCAGGTTATTTCAGATAAGCTGGAAGCACTATACTTGGATGGAACTGCAATAAAGGAACTTCCTTGTGACATTGGGAGACTCCAAAGACTTGTTATGTTGAACATGAAAGGCTGCAAGAAGCTGAAAAGGCTCCCTGACAGTCTTGGTCAGCTGAAAGCTCTTGAAGAACTTATCCTCTCTGGTTGTTCAAAGCTCAATGAGTTTCCAGAAACTTGGGGAAACATGAGCCGCTTAGAGATCTTGCTTCTGGATGAGACAGCTATAAAAGATATGCCGAAGATACTCTCCGTGCGTCGTTTATGCTTAAACAAGAATGAAAAGATCAGCCGCCTTCCAGATCTCCTCAATAAATTTTCTCAACTTCAATGGCTTCATTTGAAGTATTGTAAGAATCTTACACATGTTCCACAGCTTCCACCAAATCTTCAGTATTTAAACGTTCATGGTTGTAGCTCACTGAAGACAGTTGCAAAACCGCTGGTATGTTCTATACCGATGAAGCATGTCAATTCCTCGTTCATTTTCACTAACTGCAATGAATTGGAACAAGCTGCAAAGGAGGAAATTGTAGTATATGCTGAAAGGAAGTGTCATTTGCTTGCTAGTGCGCTTAAACGATGCGATGAGGGAGGTTCTAATATCAGGTCTATTTTCCTTGACTTGTCTGATATTACAAGAAAATGGTGCTTCTATCGCCATGCTTTTGCCATGATGAGGGATCTAAGATATCTCAAAATCTACAGCACTCATTGTCCTCAAGAATGTGAAAGTGACATTAAATTAAACTTCCCCGAAGGACTCCTGCTACCGTTGAATGAGGTGCGATATCTCCACTGGCTGAAATTCCCGTTAAAAGAAGTTCCACAAGATTTCAACCCGGGTAATTTGGTTGACCTTAAGCTTCCTTATAGCGAGATTGAACGAGTTTGGGAAGATAACAAGTGTTAGCAGCGATGAGGACGAAGTCATCAATATAATTATCCGAAAGGTTAAAGAAATACTAAATAGACGTTCAGAGGGTCCTCCTTCTAAATGTTCTGCACTACCGCCCCAAAGACACCAGAAACGTCATGAAACCTTTTGGGGAATCGAGCTCCGAATTAAGCAACTAGAAGAAAAGTTACGTTTTGGGTCGGACGAAACAACTCGTACCATCGGTGTTGTTGGGATGCCCGGTATAGGTAAAACCACTCTCGCTACGATGCTATATGAGAAGTGGAATGATAGATTCCTGAGACACGTGTTAATCCGTGATATCCATGAAGCTTCAGAGGAAGACGGGTTAAATTACTTGGCCACGAAATTCTTGCAAGGTTTATTGAAAGTTGAGAATGCCAACATCGAGTCCGTACAAGCTGCTCATGAAGCTTACAAAGATCAGTTACTCGAGACCAAAGTCCTTGTTATTCTTGACAATGTCAGTAACAAGGACCAAGTTGATGCTCTTCTTGGCGAACGCAACTGGATTAAGAAAGGAAGCAAGATTCTCATTACTACAAGCGACAAGTCATTGATGATACAAAGTTTGGTCAATGATACTTACGAAGTCCCTCCATTAAGCGACAAAGATGCCATAAAACATTTTATACGTTACGCATTTGATGGTAACGAAGGAGCTGCTCCCGGCCCCGGGCAAGGAAATTTCCCCAAGTTGTCGAAAGATTTCGTGCATTATACTAAAGGAAATCCACTAGCTCTCCAGATGTTGGGTAAGGAGCTTTTGGGGAAAGATGAGAGTCACTGGGGCTTAAAACTAAATGCATTGGATCAACACCATAACAGTCCACCTGGACAAAGCATTTGCAAGATGCTTCAAAGGGTCTGGGAAGGGAGTTATAAAGCACTGAGTCAAAAAGAAAAAGATGCACTTCTTGACATAGCTTGCTTCAGGTCGCAAGATGAGAATTACGTAGCGAGTTTATTGGATTCAGATGGCCCTAGTAATATATTGGAAGATCTCGTGAACAAGTTCATGATTAATATTTATGCTGGCAAAGTAGATATGCATGATACATTGTATATGCTCTCCAAGGAACTTGGTCGAGAAGCTACTGCTACAGATAGAAAGGGGCGGCATAGGTTGTGGCACCATCACACCATAATTGCTGTGCTGGACAAAAACAAGATGACAAGCTCCTCCTCCTGGGTGAAAACGGACGGTGAGACACCCCAAGATCAAGTGTTCATTAATTTCCGTGGAGTCGAACTGCGCAAGAACTTCGTCAGTCATCTGGAGAAGGGCTTAAAAAGGAAAGGGATCAATGCCTTCATAGACACAGATGAAGAGATGGGCCAAGAGTTGAGTGTTCTGCTCGAAAGAATAGAAGGTTCGAGGATCGCGCTAGCCATTTTCTCTCCAAGGTACACGGAGTCAAAATGGTGTTTGAAGGAGCTTGCGAAGATGAAAGAAAGAACGGAACAAAAGGAGCTCGTGGTGATTCCAATCTTCTACAAGGTACAGCCCGTCACTGTTAAAGAATTGAAGGGAGACTTCGGGGATAAGTTCAGGGAGCTGGTGAAGTCTACTGACAAGAAGACGAAGAAAGAATGGAAGGAAGCTTTACAATATGTTCCATTTTTAACCGGCATCGTGTTGGATGAGAAAAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MTSSSSWVKTDGETPQDQVFINFRGVELRKNFVSHLEKGLKRKGINAFIDTDEEMGQELSVLLERIEGSRIALAIFSPRYTESKWCLKELAKMKERTEQKELVVIPIFYKVQPVTVKELKGDFGDKFRELVKSTDKKTKKEWKEALQYVPFLTGIVLDEKSVSSDEDEVINIIIRKVKEILNRRSEGPPSKCSALPPQRHQKRHETFWGIELRIKQLEEKLRFGSDETTRTIGVVGMPGIGKTTLATMLYEKWNDRFLRHVLIRDIHEASEEDGLNYLATKFLQGLLKVENANIESVQAAHEAYKDQLLETKVLVILDNVSNKDQVDALLGERNWIKKGSKILITTSDKSLMIQSLVNDTYEVPPLSDKDAIKHFIRYAFDGNEGAAPGPGQGNFPKLSKDFVHYTKGNPLALQMLGKELLGKDESHWGLKLNALDQHHNSPPGQSICKMLQRVWEGSYKALSQKEKDALLDIACFRSQDENYVASLLDSDGPSNILEDLVNKFMINIYAGKVDMHDTLYMLSKELGREATATDRKGRHRLWHHHTIIAVLDKNKGGSNIRSIFLDLSDITRKWCFYRHAFAMMRDLRYLKIYSTHCPQECESDIKLNFPEGLLLPLNEVRYLHWLKFPLKEVPQDFNPGNLVDLKLPYSEIERVWEDNKDAPKLKWVNLNHSKKLNTLAGLGKAQNLQELNLEGCTALKEMHVDMENMKFLVFLNLRGCTSLKSLPEIQLISLKTLILSGCSKFKTFQVISDKLEALYLDGTAIKELPCDIGRLQRLVMLNMKGCKKLKRLPDSLGQLKALEELILSGCSKLNEFPETWGNMSRLEILLLDETAIKDMPKILSVRRLCLNKNEKISRLPDLLNKFSQLQWLHLKYCKNLTHVPQLPPNLQYLNVHGCSSLKTVAKPLVCSIPMKHVNSSFIFTNCNELEQAAKEEIVVYAERKCHLLASALKRCDESCVPEILFCTSFPGCEMPSWFSHDAIGSMVEFELPPHWNHNRLSGIALCVVVSFKNCKSHANLIVKFSCEQNNGEGSSSSITWKVGSLIEQDNQEETVESDHVFIGYTNCLDFIKLVKGQGGPKCAPTKASLEFSVRTGTGGEATLEVLKSGFSFVFEPEENRVPSPRNDDVKGKVKINKTPSANGCFKDQAKGNESPKGQWQTYIENSSTNIPSEAHSSQKTGFGSTLLC

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
5-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSWVKTDGETPQDQVFINFRGVELRKNFVSHLEKGLKRKGINAFIDTDEEMGQELSVLLERIEGSRIALAIFSPRYTESKWCLKELAKMKERTEQKELVVIPIFYKVQPVTVKELKGDFGDKFRELVKSTDKKTKKEWKEALQYVPFLTGI

ProfileScan: PS50104
IPR000157
15-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PQDQVFINFRGVELRKNFVSHLEKGLKRKGINAFIDTDEEMGQELSVLLERIEGSRIALAIFSPRYTESKWCLKELAKMKERTEQKELVVIPIFYKVQPVTVKELKGDFGDKFRELVKSTDKKTKKEWKEALQYVPFL

HMMSmart: SM00255
IPR000157
16-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QDQVFINFRGVELRKNFVSHLEKGLKRKGINAFIDTDEEMGQELSVLLERIEGSRIALAIFSPRYTESKWCLKELAKMKERTEQKELVVIPIFYKVQPVTVKELKGDFGDKFRELVKSTDKKTKKEWKEALQYVPFL

Gene3D: G3DSA:3.40.50.10140
18-144 G3DSA:3.40.50.10140

QVFINFRGVELRKNFVSHLEKGLKRKGINAFIDTDEEMGQELSVLLERIEGSRIALAIFSPRYTESKWCLKELAKMKERTEQKELVVIPIFYKVQPVTVKELKGDFGDKFRELVKSTDKKTKKEWKE

HMMPfam: PF01582
IPR000157
19-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFINFRGVELRKNFVSHLEKGLKRKGINAFIDTDEEMGQELSVLLERIEGSRIALAIFSPRYTESKWCLKELAKMKERTEQKELVVIPIFYKVQPVTVKELKGDFGDKFRELVKSTDKKTKKEWKEALQ

HMMPanther: PTHR23155:SF247
26-936 PTHR23155:SF247,SUBFAMILY NOT NAMED

VELRKNFVSHLEKGLKRKGINAFIDTDEEMGQELSVLLERIEGSRIALAIFSPRYTESKWCLKELAKMKERTEQKELVVIPIFYKVQPVTVKELKGDFGDKFRELVKSTDKKTKKEWKEALQYVPFLTGIVLDEKSVSSDEDEVINIIIRKVKEILNRRSEGPPSKCSALPPQRHQKRHETFWGIELRIKQLEEKLRFGSDETTRTIGVVGMPGIGKTTLATMLYEKWNDRFLRHVLIRDIHEASEEDGLNYLATKFLQGLLKVENANIESVQAAHEAYKDQLLETKVLVILDNVSNKDQVDALLGERNWIKKGSKILITTSDKSLMIQSLVNDTYEVPPLSDKDAIKHFIRYAFDGNEGAAPGPGQGNFPKLSKDFVHYTKGNPLALQMLGKELLGKDESHWGLKLNALDQHHNSPPGQSICKMLQRVWEGSYKALSQKEKDALLDIACFRSQDENYVASLLDSDGPSNILEDLVNKFMINIYAGKVDMHDTLYMLSKELGREATATDRKGRHRLWHHHTIIAVLDKNKGGSNIRSIFLDLSDITRKWCFYRHAFAMMRDLRYLKIYSTHCPQECESDIKLNFPEGLLLPLNEVRYLHWLKFPLKEVPQDFNPGNLVDLKLPYSEIERVWEDNKDAPKLKWVNLNHSKKLNTLAGLGKAQNLQELNLEGCTALKEMHVDMENMKFLVFLNLRGCTSLKSLPEIQLISLKTLILSGCSKFKTFQVISDKLEALYLDGTAIKELPCDIGRLQRLVMLNMKGCKKLKRLPDSLGQLKALEELILSGCSKLNEFPETWGNMSRLEILLLDETAIKDMPKILSVRRLCLNKNEKISRLPDLLNKFSQLQWLHLKYCKNLTHVPQLPPNLQYLNVHGCSSLKTVAKPLVCSIPMKHVNSSFIFTNCNELEQAAKEE

HMMPanther: PTHR23155
26-936 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VELRKNFVSHLEKGLKRKGINAFIDTDEEMGQELSVLLERIEGSRIALAIFSPRYTESKWCLKELAKMKERTEQKELVVIPIFYKVQPVTVKELKGDFGDKFRELVKSTDKKTKKEWKEALQYVPFLTGIVLDEKSVSSDEDEVINIIIRKVKEILNRRSEGPPSKCSALPPQRHQKRHETFWGIELRIKQLEEKLRFGSDETTRTIGVVGMPGIGKTTLATMLYEKWNDRFLRHVLIRDIHEASEEDGLNYLATKFLQGLLKVENANIESVQAAHEAYKDQLLETKVLVILDNVSNKDQVDALLGERNWIKKGSKILITTSDKSLMIQSLVNDTYEVPPLSDKDAIKHFIRYAFDGNEGAAPGPGQGNFPKLSKDFVHYTKGNPLALQMLGKELLGKDESHWGLKLNALDQHHNSPPGQSICKMLQRVWEGSYKALSQKEKDALLDIACFRSQDENYVASLLDSDGPSNILEDLVNKFMINIYAGKVDMHDTLYMLSKELGREATATDRKGRHRLWHHHTIIAVLDKNKGGSNIRSIFLDLSDITRKWCFYRHAFAMMRDLRYLKIYSTHCPQECESDIKLNFPEGLLLPLNEVRYLHWLKFPLKEVPQDFNPGNLVDLKLPYSEIERVWEDNKDAPKLKWVNLNHSKKLNTLAGLGKAQNLQELNLEGCTALKEMHVDMENMKFLVFLNLRGCTSLKSLPEIQLISLKTLILSGCSKFKTFQVISDKLEALYLDGTAIKELPCDIGRLQRLVMLNMKGCKKLKRLPDSLGQLKALEELILSGCSKLNEFPETWGNMSRLEILLLDETAIKDMPKILSVRRLCLNKNEKISRLPDLLNKFSQLQWLHLKYCKNLTHVPQLPPNLQYLNVHGCSSLKTVAKPLVCSIPMKHVNSSFIFTNCNELEQAAKEE

Gene3D: G3DSA:3.40.50.300
200-368 G3DSA:3.40.50.300

HQKRHETFWGIELRIKQLEEKLRFGSDETTRTIGVVGMPGIGKTTLATMLYEKWNDRFLRHVLIRDIHEASEEDGLNYLATKFLQGLLKVENANIESVQAAHEAYKDQLLETKVLVILDNVSNKDQVDALLGERNWIKKGSKILITTSDKSLMIQSLVNDTYEVPPLSD

HMMPfam: PF00931
IPR002182
213-483 NB-ARC,NBS
NB-ARC

RIKQLEEKLRFGSDETTRTIGVVGMPGIGKTTLATMLYEKWNDRFLRHVLIRDIHEASEEDGLNYLATKFLQGLLKVENANIESVQAAHEAYKDQLLETKVLVILDNVSNKDQVDALLGERNWIKKGSKILITTSDKSLMIQSLVNDTYEVPPLSDKDAIKHFIRYAFDGNEGAAPGPGQGNFPKLSKDFVHYTKGNPLALQMLGKELLGKDESHWGLKLNALDQHHNSPPGQSICKMLQRVWEGSYKALSQKEKDALLDIACFRSQDENY

superfamily: SSF52540
227-441 SSF52540

ETTRTIGVVGMPGIGKTTLATMLYEKWNDRFLRHVLIRDIHEASEEDGLNYLATKFLQGLLKVENANIESVQAAHEAYKDQLLETKVLVILDNVSNKDQVDALLGERNWIKKGSKILITTSDKSLMIQSLVNDTYEVPPLSDKDAIKHFIRYAFDGNEGAAPGPGQGNFPKLSKDFVHYTKGNPLALQMLGKELLGKDESHWGLKLNALDQHHNS

FPrintScan: PR00364
IPR000767
231-246 DISEASERSIST
Disease resistance protein

TIGVVGMPGIGKTTLA

FPrintScan: PR00364
IPR000767
307-321 DISEASERSIST
Disease resistance protein

QLLETKVLVILDNVS

FPrintScan: PR00364
IPR000767
406-420 DISEASERSIST
Disease resistance protein

TKGNPLALQMLGKEL

superfamily: SSF52058
514-973 SSF52058,LRR

DMHDTLYMLSKELGREATATDRKGRHRLWHHHTIIAVLDKNKGGSNIRSIFLDLSDITRKWCFYRHAFAMMRDLRYLKIYSTHCPQECESDIKLNFPEGLLLPLNEVRYLHWLKFPLKEVPQDFNPGNLVDLKLPYSEIERVWEDNKDAPKLKWVNLNHSKKLNTLAGLGKAQNLQELNLEGCTALKEMHVDMENMKFLVFLNLRGCTSLKSLPEIQLISLKTLILSGCSKFKTFQVISDKLEALYLDGTAIKELPCDIGRLQRLVMLNMKGCKKLKRLPDSLGQLKALEELILSGCSKLNEFPETWGNMSRLEILLLDETAIKDMPKILSVRRLCLNKNEKISRLPDLLNKFSQLQWLHLKYCKNLTHVPQLPPNLQYLNVHGCSSLKTVAKPLVCSIPMKHVNSSFIFTNCNELEQAAKEEIVVYAERKCHLLASALKRCDESCVPEILFCTSFPGCE

Gene3D: G3DSA:3.80.10.10
581-732 G3DSA:3.80.10.10

FAMMRDLRYLKIYSTHCPQECESDIKLNFPEGLLLPLNEVRYLHWLKFPLKEVPQDFNPGNLVDLKLPYSEIERVWEDNKDAPKLKWVNLNHSKKLNTLAGLGKAQNLQELNLEGCTALKEMHVDMENMKFLVFLNLRGCTSLKSLPEIQLI

HMMPfam: PF07725
IPR011713
641-660 LRR_3
Leucine-rich repeat 3

NLVDLKLPYSEIERVWEDNK

Gene3D: G3DSA:3.80.10.10
733-901 G3DSA:3.80.10.10

SLKTLILSGCSKFKTFQVISDKLEALYLDGTAIKELPCDIGRLQRLVMLNMKGCKKLKRLPDSLGQLKALEELILSGCSKLNEFPETWGNMSRLEILLLDETAIKDMPKILSVRRLCLNKNEKISRLPDLLNKFSQLQWLHLKYCKNLTHVPQLPPNLQYLNVHGCSSL

FPrintScan: PR00364
IPR000767
797-813 DISEASERSIST
Disease resistance protein

GQLKALEELILSGCSKL

HMMPfam: PF13504
888-903 LRR_7,Leucine rich repeat

PNLQYLNVHGCSSLKT


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox