PRGDB00044729 (At5g38850)

From PRG Wiki
Jump to: navigation, search
At5g38850
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108740581 (DQ528338)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype KNO-18 disease resistance protein (At5g38850) gene, partial cds.

DNA Sequence

TCTCAAGAAGATGTCTTTGTCAAGTTCATGGTATTTAAAGAAACTTCCGGATCTGTCAAATGCTACAAATCTCGAAGAATTGGATCTGAGAGCTTGCCAGAATTTAGTAGAGCTTCCTTCCTCCTTTTCTTATCTGCATAAGCTAAAGTATTTGAATATGATGGGATGCAGAAGGCTAAAAGAAGTTCCACCTCATATCAACTTGAAGTCTCTTGAATTGGTCAACATGTATGGATGCTCAAGATTAAAAAGCTTTCCAGATATTTCTACAAACATCAGTTCACTCGACATATCATACACTGATGTGGAAGAACTACCTGAATCAATGACGATGTGGTCTCGCCTACGTACTCTCGAAATATACAAAAGTAGAAACCTCAAGATAGTAACACATGTGCCCATAAACCTAACATATCTAGACCTCAGCGAGACTAGAATTGAGAAGATTCCAGATGACATCAAAAATGTTCATGGGCTGCAAATTTTATTTCTAGGTGGCTGCAGAAAACTCGCATCATTGCCAGAGCTTCCTGGTTCGCTCTT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

LKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPINLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-180 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPINLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSL

superfamily: SSF52058
1-180 SSF52058,LRR

LKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPINLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSL

Gene3D: G3DSA:3.80.10.10
1-175 G3DSA:3.80.10.10

LKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPINLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPE

HMMPanther: PTHR11017:SF20
1-180 PTHR11017:SF20,SUBFAMILY NOT NAMED

LKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPINLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSL

HMMPfam: PF13855
22-79 LRR_8,Leucine rich repeat

TNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGC

ProfileScan: PS51450
IPR001611
23-45 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEELDLRACQNLVELPSSFSYL

ProfileScan: PS51450
IPR001611
47-69 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKYLNMMGCRRLKEVPPHINLK

ProfileScan: PS51450
IPR001611
135-156 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTYLDLSETRIEKIPDDIKNV

HMMPfam: PF00560
IPR001611
135-155 LRR_1
Leucine-rich repeat

NLTYLDLSETRIEKIPDDIKN


List of References

Erica G Bakker, Christopher Toomajian, Martin Kreitman, Joy Bergelson
A genome-wide survey of R gene polymorphisms in Arabidopsis.
Plant Cell: 2006, 18(8);1803-18
PubMed:16798885 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox