PRGDB00044750 (At5g38850)

From PRG Wiki
Jump to: navigation, search
At5g38850
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108740539 (DQ528317)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype CS22491 disease resistance protein (At5g38850) gene, partial cds.

DNA Sequence

TCTCAAGAAGATGTCTTTGTCAAGTTCATGGTATTTAAAGAAACTTCCGGATCTGTCAAATGCTACAAATCTCGAAGAATTGGATCTGAGAGCTTGCCAGAATTTAGTAGAGCTTCCTTCCTCCTTTTCTTATCTGCATAAGCTAAAGTATTTGAATATGATGGGATGCAGAAGGCTAAAAGAAGTTCCACCTCATATAAACTTGAAGTCTCTTGAATTGGTCAACATGTATGGATGCTCAAGATTAAAAAGCTTTCCAGATATTTCTACAAACATCAGTTCACTCGACATATCATACACTGATGTGGAAGAACTACCTGAATCAATGACGATGTGGTCTCGCCTACGTACTCTCGAAATATACAAAAGTAGAAACCTCAAGATAGTAACACATGTGCCCATAAACCTAACATATCTAGACCTCAGCGAGACTAGAATTGAGAAGATTCCAGATGACATCAAAAATGTTCATGGGCTGCAAATTTTATTTCTAGGTGGCTGCAGAAAACTCGCATCATTGCCAGAGCTTCCTGGTTCGCT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

LKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPINLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-180 PTHR11017:SF20,SUBFAMILY NOT NAMED

LKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPINLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSL

Gene3D: G3DSA:3.80.10.10
1-175 G3DSA:3.80.10.10

LKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPINLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPE

HMMPanther: PTHR11017
1-180 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPINLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSL

superfamily: SSF52058
1-180 SSF52058,LRR

LKKMSLSSSWYLKKLPDLSNATNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGCSRLKSFPDISTNISSLDISYTDVEELPESMTMWSRLRTLEIYKSRNLKIVTHVPINLTYLDLSETRIEKIPDDIKNVHGLQILFLGGCRKLASLPELPGSL

HMMPfam: PF13855
22-79 LRR_8,Leucine rich repeat

TNLEELDLRACQNLVELPSSFSYLHKLKYLNMMGCRRLKEVPPHINLKSLELVNMYGC

ProfileScan: PS51450
IPR001611
23-45 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEELDLRACQNLVELPSSFSYL

ProfileScan: PS51450
IPR001611
47-69 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKYLNMMGCRRLKEVPPHINLK

HMMPfam: PF00560
IPR001611
135-155 LRR_1
Leucine-rich repeat

NLTYLDLSETRIEKIPDDIKN

ProfileScan: PS51450
IPR001611
135-156 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTYLDLSETRIEKIPDDIKNV


List of References

Erica G Bakker, Christopher Toomajian, Martin Kreitman, Joy Bergelson
A genome-wide survey of R gene polymorphisms in Arabidopsis.
Plant Cell: 2006, 18(8);1803-18
PubMed:16798885 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox