PRGDB00044769 (At5g11250)

From PRG Wiki
Jump to: navigation, search
At5g11250
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108740470 (DQ528241)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Var-2-6 disease resistance protein (At5g11250) gene, partial cds.

DNA Sequence

ATGTTTGTGTTATTTGTCTGTACAGCCGCTTCATAATCTCAGGCAGATGGATTTGAGTTATTCTGTAAACTTGAAGGAGCTTCCTGATCTCTCAACTGCCATTAATCTCCGAAAGTTGATTCTTTCTAATTGCTCCAGTCTGATCAAACTCCCTTCTTGTATTGGGAATGCCACCAATCTCGAGGATTTAGATCTTAATGGATGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGGGATGCCATTAACCTTCAAAAATTGCTTCTTCGCTATTGCTCAAATCTGGTGGAGCTCCCCTCTTCTATTGGGAATGCCATTAATCTTCGGGAATTGGATCTTTATTATTGCTCGAGTCTGATCAGACTTCCCTCCTCTATTGGGAATGCCATTAATCTTTTGATTTTAGATCTTAACGGATGCTCAAATCTATTGGAGCTCCCATCCTCCATTGGGAATGCCATTAATCTCCAAAAACTGGATCTTCGCAGATGCGCAAAGCTATTAGAGCTCCCGTCTTCTATTGGGNATGCCATTNATCTCCAAAACCTGCTTCTTGACGATTGCTCAAGTCTGTTGGAGCTCCCCTCGTCTATTGGGAATGCCACTAATTTAGTGTACATGAACCTTAGTAATTGCTCAAATCTGGTGGAGCTTCCTCTTTCTATAGGAAACCTTCAGAAGTTGCAGGAATTGATTTTAAAAGGATGCTCTNAGCTAGAGGATCTTCCCATCAACATCAACTTGGAATCTTTGGACATACTTGTGCTCAATGATTGCTCCATGTTGAAAAGGTTTCCTGAGATCTCTACTAACGTTAGAGCTCTCTATCTCTGTGGAACCGCAATAGAAGAAGTGCCTCTCTCGATCAGGTCATGGCCCCGTCTTGATGAATTGCTGATGTCATACTTTGATAATCTAGTGGAATTCCCTCATGTTCTTGACATCATCACAAATCTGGACTTGAACGGTAAAGAAATACAAGAGGTTCCTCCACTGATCAAGAGAATATCTCGTCTTCAGACACTCATACTCAAGGGGTACAGAAAGGTGGTATCACTCCCACAGATTCCAGATTCTTTAAAATGGATTGATGCTGAAGATTGTGAGTCCTTGGAGAGACTAGATTGCTCCTTTCACAATCCAGAGATTACTCTCTTCTTTGGTAAGTGCTTTAAACTTAATCAAGAAGCAAGAGACCTAATCATCCAGACACCGACTAAACAAGCAGTCTTACCTGGTAGAGAGGT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

CLCYLSVQPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNATNLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGXAIXLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSXLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLNGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF292
10-415 PTHR23155:SF292,SUBFAMILY NOT NAMED

LHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNATNLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGXAIXLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSXLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLNGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREV

HMMPanther: PTHR23155
10-415 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNATNLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGXAIXLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSXLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLNGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREV

Gene3D: G3DSA:3.80.10.10
10-203 G3DSA:3.80.10.10

LHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNATNLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGXAIXLQNLLLDDCSSLLELPSSIGNATNL

superfamily: SSF52058
11-265 SSF52058,LRR

HNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNATNLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGXAIXLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSXLEDLPININLESLDILVLNDCSMLKRFP

HMMPfam: PF13504
35-51 LRR_7,Leucine rich repeat

NLRKLILSNCSSLIKLP

HMMPfam: PF13504
58-75 LRR_7,Leucine rich repeat

TNLEDLDLNGCSSLVELP

HMMPfam: PF00560
IPR001611
82-103 LRR_1
Leucine-rich repeat

NLQKLLLRYCSNLVELPSSIGN

HMMPfam: PF00560
IPR001611
106-127 LRR_1
Leucine-rich repeat

NLRELDLYYCSSLIRLPSSIGN

HMMPfam: PF00560
IPR001611
130-151 LRR_1
Leucine-rich repeat

NLLILDLNGCSNLLELPSSIGN

HMMPfam: PF00560
IPR001611
154-173 LRR_1
Leucine-rich repeat

NLQKLDLRRCAKLLELPSSI

HMMPfam: PF00560
IPR001611
202-224 LRR_1
Leucine-rich repeat

NLVYMNLSNCSNLVELPLSIGNL

Gene3D: G3DSA:3.80.10.10
204-376 G3DSA:3.80.10.10

VYMNLSNCSNLVELPLSIGNLQKLQELILKGCSXLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLNGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCS

superfamily: SSF52058
269-392 SSF52058,LRR

TNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLNGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox