PRGDB00044771 (At5g11250)

From PRG Wiki
Jump to: navigation, search
At5g11250
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108740466 (DQ528239)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Uod-1 disease resistance protein (At5g11250) gene, partial cds.

DNA Sequence

ATGTTTGTGTTATTTGTCTGTACAGCCGCTTCATAATCTCAGGCAGATGGATTTGAGTTATTCTGTAAACTTGAAGGAGCTTCCTGATCTCTCAACTGCCATTAATCTCCGAAAGTTGATTCTTTCTAATTGCTCCAGTCTGATCAAACTCCCTTCTTGTATTGGGAATGCCATCAATCTCGAGGATTTAGATCTTAATGGATGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGGGATGCCATTAACCTTCAAAAATTGCTTCTTCGCTATTGCTCAAATCTGGTGGAGCTCCCCTCTTCTATTGGGAATGCCATTAATCTTCGGGAATTGGATCTTTATTATTGCTCGAGTCTGATCAGACTTCCCTCCTCTNNTGGGAATGCCATTAATCTTTTGATTTNAGATCTNAACGGATGCTCAAATCTATTGGAGCTCCCATCCTCCATTGGGAATGCCATTAATCTCCAAAAACTGGATCTTCGCAGATGCGCAAAGCTATTAGAGCTCCCGTCTTCTATTGGGNATGCCATTAATCTCCAAAACCTGCTTCTTGACGATTGCTCAAGTCTGTTGGAGCTCCCCTCGTCTATTGGGAATGCCACTAATTTAGTGTACATGAACCTTAGTAATTGCTCAAATCTGGTGGAGCTTCCTCTTTCTATAGGAAACCTTCAGAAGTTGCAGGAATTGATTTTAAAAGGATGCTCTAAGCTAGAGGATCTTCCCATCNACATCAACTTGGAATCTTTGGACATACTTGTGCTCAATGATTGCTCCATGTTGAAAAGGTTTCCTGAGATCTCTACTAACGTTAGAGCTCTCTATCTCTGTGGAACCGCAATAGAAGAAGTGCCTCTCTCGATCAGGTCATGGCCCCGTCTTGATGAATTGCTGATGTCATACTTTGATAATCTAGTGGAATTCCCTCATGTTCTTGACATCATCACAAATCTGGACTTGAGCGGTAAAGAAATACAAGAGGTTCCTCCACTGATCAAGAGAATATCTCGTCTTCAGACACTCATACTCAAGGGGTACAGAAAGGTGGTATCACTCCCACAGATTCCAGATTCTTTAAAATGGATTGATGCTGAAGATTGTGAGTCCTTGGAGAGACTAGATTGCTCCTTTCACAATCCAGAGATTACTCTCTTCTTTGGTAAGTGCTTTAAACTTAATCAAGAAGCAAGAGACCTAATCATCCAGACACCGACTAAACAAGCAGTCTTACCTGGTAGAGAGGT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

CLCYLSVQPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSXGNAINLLIXDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGXAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPIXINLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREV


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
8-242 G3DSA:3.80.10.10

QPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSXGNAINLLIXDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGXAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLP

HMMPanther: PTHR23155:SF292
10-415 PTHR23155:SF292,SUBFAMILY NOT NAMED

LHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSXGNAINLLIXDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGXAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPIXINLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREV

HMMPanther: PTHR23155
10-415 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSXGNAINLLIXDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGXAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPIXINLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTKQAVLPGREV

superfamily: SSF52058
11-265 SSF52058,LRR

HNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSXGNAINLLIXDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGXAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPIXINLESLDILVLNDCSMLKRFP

HMMPfam: PF13504
35-51 LRR_7,Leucine rich repeat

NLRKLILSNCSSLIKLP

HMMPfam: PF00560
IPR001611
59-78 LRR_1
Leucine-rich repeat

NLEDLDLNGCSSLVELPSFG

HMMPfam: PF00560
IPR001611
82-103 LRR_1
Leucine-rich repeat

NLQKLLLRYCSNLVELPSSIGN

HMMPfam: PF13504
106-122 LRR_7,Leucine rich repeat

NLRELDLYYCSSLIRLP

HMMPfam: PF00560
IPR001611
154-173 LRR_1
Leucine-rich repeat

NLQKLDLRRCAKLLELPSSI

HMMPfam: PF00560
IPR001611
202-224 LRR_1
Leucine-rich repeat

NLVYMNLSNCSNLVELPLSIGNL

superfamily: SSF52058
246-379 SSF52058,LRR

NLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHN

Gene3D: G3DSA:3.80.10.10
268-376 G3DSA:3.80.10.10

STNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCS


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox