PRGDB00044781 (At5g11250)

From PRG Wiki
Jump to: navigation, search
At5g11250
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108740446 (DQ528229)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype RMX-A180 disease resistance protein (At5g11250) gene, partial cds.

DNA Sequence

ATGTTTGTGTTATTTGTCTGTACAGCCGCTTCAAAATCTCAGGCAGATGGATTTGAGTTATTCTGTAAACTTGAAGGAGCTTCCTGATCTCTCAACTGCCATTTATCTCCGAAAGTTGTTTCTTTCTGGTTGCTCCAGTCTGATCAAACTCCCTTCTTGTATTGGGAATGCCACCAATCTCGAGGATTTAGATCTTAATGGATGCTCAAGTCTTGCGGAGCTTCCCTCTTTTGGGGATGCCATTAACCTTCAAAAATNGCTTCTTCGCCATTGCTCAAATCTGGTGGAGCTCCCCTCTATTGGNAATGCCATTAATCTTCGGGAATNGGATCTTTATTATTGCTCGAGTCTGATCAGACTTCCCTCCTCTATTGGGAATGCCATTAATCTTTTGATTTTAGATCTTAACGGATGCTCAAATCTATTGGAGCTCCCATCCTCCATTGGGAATGCCATTAATCTCCAAAAACTGGATCTTCGCAGATGCGCAAAGCTATTAGAGCTCCCGTCTTCTATTGGGAATGCCATTAATCTCCAAAACCTGCTTCTTGACGATTGCTCAAGTCTGTTGAAGCTCCCCTCGTCTATTGGGAATGCCACTAATTTAGTGTACATGAACCTTAGTAATTGCTCAAATCTGGTGGAGCTTCCTCTTTCTATAGGAAACCTTCAGAAGTTGCAGGAATTGATTTTAAAAGGATGCTCTAAGCTAGAGGATCTTCCCATCAACATCAACTTGGAATCTTTGGACAGACTTGTGCTCAATGATTGCTCCATGTTGAAAAGGTTTCCTGAGATCTCTACANACGTTAGAGCTCTCTATCTCTGTGGAACCGCAATAGAAGAAGTGCCTCTCTCGATCAGGTCATGGCCCCGTCTTGATGAATTGCTGATGTCATACTTTGATAATTTAATTGAATTCCCTCATGTTCTTGACATCATCACAAATCTGGACTTGAGCGATAAAGATTTACAAGAGGTTCCTCCACTGATCAAGAGAATATCTCGTCTTCAGACACTCATACTCAAGGGGTACAGAAAGGTGGTATCACTCCCACAGATTCCAGATTCTTTAAAATGGATTGATGCTGAAGATTGTGAGTCCTTGGAGAGACTAGATTGCTCCTTTCACAATCCAGAGATTACTCTCTTCTTTGGTAAGTGCTTTAAACTTAATCAAGAAGCAAGAGACCTAATCATCCAGACACCGACTAGACAAGCAGTCTTACCTGGTAGAGAGGT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

CLCYLSVQPLQNLRQMDLSYSVNLKELPDLSTAIYLRKLFLSGCSSLIKLPSCIGNATNLEDLDLNGCSSLAELPSFGDAINLQKXLLRHCSNLVELPSIGNAINLREXDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLKLPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDRLVLNDCSMLKRFPEISTXVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLIEFPHVLDIITNLDLSDKDLQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTRQAVLPGREV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF292
10-414 PTHR23155:SF292,SUBFAMILY NOT NAMED

LQNLRQMDLSYSVNLKELPDLSTAIYLRKLFLSGCSSLIKLPSCIGNATNLEDLDLNGCSSLAELPSFGDAINLQKXLLRHCSNLVELPSIGNAINLREXDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLKLPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDRLVLNDCSMLKRFPEISTXVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLIEFPHVLDIITNLDLSDKDLQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTRQAVLPGREV

HMMPanther: PTHR23155
10-414 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LQNLRQMDLSYSVNLKELPDLSTAIYLRKLFLSGCSSLIKLPSCIGNATNLEDLDLNGCSSLAELPSFGDAINLQKXLLRHCSNLVELPSIGNAINLREXDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLKLPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDRLVLNDCSMLKRFPEISTXVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLIEFPHVLDIITNLDLSDKDLQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTRQAVLPGREV

Gene3D: G3DSA:3.80.10.10
10-201 G3DSA:3.80.10.10

LQNLRQMDLSYSVNLKELPDLSTAIYLRKLFLSGCSSLIKLPSCIGNATNLEDLDLNGCSSLAELPSFGDAINLQKXLLRHCSNLVELPSIGNAINLREXDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLKLPSSIGNATN

superfamily: SSF52058
11-264 SSF52058,LRR

QNLRQMDLSYSVNLKELPDLSTAIYLRKLFLSGCSSLIKLPSCIGNATNLEDLDLNGCSSLAELPSFGDAINLQKXLLRHCSNLVELPSIGNAINLREXDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLKLPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDRLVLNDCSMLKRFP

HMMPfam: PF00560
IPR001611
59-78 LRR_1
Leucine-rich repeat

NLEDLDLNGCSSLAELPSFG

HMMPfam: PF00560
IPR001611
129-150 LRR_1
Leucine-rich repeat

NLLILDLNGCSNLLELPSSIGN

HMMPfam: PF00560
IPR001611
153-174 LRR_1
Leucine-rich repeat

NLQKLDLRRCAKLLELPSSIGN

HMMPfam: PF00560
IPR001611
201-223 LRR_1
Leucine-rich repeat

NLVYMNLSNCSNLVELPLSIGNL

Gene3D: G3DSA:3.80.10.10
202-375 G3DSA:3.80.10.10

LVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDRLVLNDCSMLKRFPEISTXVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLIEFPHVLDIITNLDLSDKDLQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCS

superfamily: SSF52058
245-378 SSF52058,LRR

NLESLDRLVLNDCSMLKRFPEISTXVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLIEFPHVLDIITNLDLSDKDLQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHN


List of References

Erica G Bakker, Christopher Toomajian, Martin Kreitman, Joy Bergelson
A genome-wide survey of R gene polymorphisms in Arabidopsis.
Plant Cell: 2006, 18(8);1803-18
PubMed:16798885 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox