PRGDB00044801 (At5g11250)

From PRG Wiki
Jump to: navigation, search
At5g11250
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108740406 (DQ528209)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype KZ9 disease resistance protein (At5g11250) gene, partial cds.

DNA Sequence

TTTGTGTTATTTGTCTGTACAGCCGCTTCATAATCTCAGGCAGATGGATTTGAGTTATTCTGTAAACTTGAAGGAGCTTCCTGATCTCTCAACTGCCATTAATCTCCGAAAGTTGATTCTTTCTAATTGCTCCAGTCTGATCAAACTCCCTTCTTGTATTGGGAATGCCATCAATCTCGAGGATTTAGATCTTAATGGATGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGGGATGCCATTAACCTTCAAAAATTGCTTCTTCGCTATTGCTCAAATCTGGTGGAGCTCCCCTCTTCTATTGGGAATGCCATTAATCTTCGGGAATTGGATCTTTATTATTGCTCGAGTCTGATCAGACTTCCCTCCTCTATTGGGAATGCCATTAATCTTTTGATTTTAGATCTTAACGGATGCTCAAATCTATTGGAGCTCCCATCCTCCATTGGGAATGCCATTAATCTCCAAAAACTGGATCTTCGCAGATGCGCAAAGCTATTAGAGCTCCCGTCTTCTATTGGGAATGCCATTAATCTCCAAAACCTGCTTCTTGACGATTGCTCAAGTCTGTTGGAGCTCCCCTCGTCTATTGGGAATGCCACTNATTTAGTGTACATGAACCTTAGTAATTGCTCAAATCTGGTGGAGCTTCCTCTTTCTATAGGAAACCTTCAGAAGTTGCAGGAATTGATTTTAAAAGGATGCTCTAAGCTAGAGGATCTTCCCATCAACATCAACTTGGAATCTTTGGACATACTTGTGCTCAATGATTGCTCCATGTTGAAAAGGTTTCCTGAGATCTCTACTAACGTTAGAGCTCTCTATCTCTGTGGAACCGCAATAGAAGAAGTGCCTCTCTCGATCAGGTCATGGCCCCGTCTTGATGAATTGCTGATGTCATACTTTGATAATCTAGTGGAATTCCCTCATGTTCTTGACATCATCACAAATCTGGACTTGAGCGGTAAAGAAATACAAGAGGTTCCTCCACTGATCAAGAGAATATCTCGTCTTCAGACACTCATACTCAAGGGGTACAGAAAGGTGGTATCACTCCCACAGATTCCAGATTCTTTAAAATGGATTGATGCTGAAGATTGTGAGTCCTTGGAGAGACTAGATTGCTCCTTTCACAATCCAGAGATTACTCTCTTCTTTGGTAAGTGCTTTAAACTTAATCAAGAAGCAAGAGACCTAATCA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

LCYLSVQPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATXLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLI


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
5-241 SSF52058,LRR

SVQPLHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATXLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLP

Gene3D: G3DSA:3.80.10.10
9-202 G3DSA:3.80.10.10

LHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATXL

HMMPanther: PTHR23155:SF292
9-387 PTHR23155:SF292,SUBFAMILY NOT NAMED

LHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATXLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGK

HMMPanther: PTHR23155
9-387 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LHNLRQMDLSYSVNLKELPDLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSLVELPSFGDAINLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATXLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGK

HMMPfam: PF13504
34-50 LRR_7,Leucine rich repeat

NLRKLILSNCSSLIKLP

HMMPfam: PF00560
IPR001611
58-77 LRR_1
Leucine-rich repeat

NLEDLDLNGCSSLVELPSFG

HMMPfam: PF00560
IPR001611
81-102 LRR_1
Leucine-rich repeat

NLQKLLLRYCSNLVELPSSIGN

HMMPfam: PF00560
IPR001611
105-126 LRR_1
Leucine-rich repeat

NLRELDLYYCSSLIRLPSSIGN

HMMPfam: PF00560
IPR001611
129-150 LRR_1
Leucine-rich repeat

NLLILDLNGCSNLLELPSSIGN

HMMPfam: PF00560
IPR001611
153-174 LRR_1
Leucine-rich repeat

NLQKLDLRRCAKLLELPSSIGN

superfamily: SSF52058
177-391 SSF52058,LRR

NLQNLLLDDCSSLLELPSSIGNATXLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKL

HMMPfam: PF00560
IPR001611
202-223 LRR_1
Leucine-rich repeat

LVYMNLSNCSNLVELPLSIGNL

Gene3D: G3DSA:3.80.10.10
203-375 G3DSA:3.80.10.10

VYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLVEFPHVLDIITNLDLSGKEIQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCS


List of References

Erica G Bakker, Christopher Toomajian, Martin Kreitman, Joy Bergelson
A genome-wide survey of R gene polymorphisms in Arabidopsis.
Plant Cell: 2006, 18(8);1803-18
PubMed:16798885 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox