PRGDB00044817 (At5g11250)

From PRG Wiki
Jump to: navigation, search
At5g11250
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108740373 (DQ528192)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Ei-2 disease resistance protein (At5g11250) gene, partial cds.

DNA Sequence

ATGTTTGTGTTATTTGTCTGTACAGCCGCTTCATAATCTCAGGCAGATGGATTTGAGTTATTCTGTAAACTTGAAGGAGCTTCCTGATCTCTCAACTGCCATTAATCTCCGAAAGTTGTTTCTTTCTGGTTGCTCCAGTCTGATCAAACTCCCTTCTTGTATTGGGAATGCCACCAATCTCGAGGATTTAGATCTTAATGGATGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGGGATGCCATTAACCTTCAAAAATTGCTTCTTCGCCATTGCTCAAATCTGGTGGAGCTCCCCTCTATTGGAAATGCCATTAATCTTCGGGAATTGGTTCTTTATTATTGCTCGAGTCTGATCAGACTTCCCTCCTCTATTGGGAATGCCATTAATCTTTTGATTTTAGATCTTAACGGATGCTCAAATCTATTGGAGCTCCCATCCTCCATTGGGAATGCCATTAATCTCCAAAAACTGGATCTTCGCAGATGCGCAAAGCTATTAGAGCTCCCGTCTTCTATTGGGAATGCCATTAATCTCCAAAACCTGCTTCTTGACGATTGCTCAAGTCTGTTGAAGCTCCCCTCGTCTATTGGGAATGCCACTAATTTAGTGTACATGAACCTTAGTAATTGCTCAAATCTGGTGGAGCTTCCTCTTTCTATAGGAAACCTTCAGAAGTTGCAGGAATTGATTTTAAAAGGATGCTCTAAGCTAGAGGATCTTCCCATCAACATCAACTTGGAATCTTTGGACAGACTTGTGCTCAATGATTGCTCCATGTTGAAAAGGTTTCCTGAGATCTCTACAAACGTTAGAGCTCTCTATCTCTGTGGAACCGCAATAGAAGAAGTGCCTCTCTCGATCAGGTCATGGCCCCGTCTTGATGAATTGCTGATGTCATACTTTGATAATTTAATTGAATTCCCTCATGTTCTTGACATCATCACAAATCTGGTCTTGAGCGATAAAGATTTACAAGAGGTTCCTCCACTGATCAAGAGAATATCTCGTCTTCAGACACTCATACTCAAGGGGTACAGAAAGGTGGTATCACTCCCACAGATTCCAGATTCTTTAAAATGGATTGATGCTGAAGATTGTGAGTCCTTGGAGAGACTAGATTGCTCCTTTCACAATCCAGAGATTACTCTCTTCTTTGGTAAGTGCTTTAAACTTAATCAAGAAGCAAGAGACCTAATCATCCAGACACCGACTAGACAAGCAGTCTTACCTGGTAGAGAGGT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

CLCYLSVQPLHNLRQMDLSYSVNLKELPDLSTAINLRKLFLSGCSSLIKLPSCIGNATNLEDLDLNGCSSLVELPSFGDAINLQKLLLRHCSNLVELPSIGNAINLRELVLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLKLPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDRLVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLIEFPHVLDIITNLVLSDKDLQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTRQAVLPGREV


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
10-202 G3DSA:3.80.10.10

LHNLRQMDLSYSVNLKELPDLSTAINLRKLFLSGCSSLIKLPSCIGNATNLEDLDLNGCSSLVELPSFGDAINLQKLLLRHCSNLVELPSIGNAINLRELVLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLKLPSSIGNATNL

HMMPanther: PTHR23155:SF292
10-414 PTHR23155:SF292,SUBFAMILY NOT NAMED

LHNLRQMDLSYSVNLKELPDLSTAINLRKLFLSGCSSLIKLPSCIGNATNLEDLDLNGCSSLVELPSFGDAINLQKLLLRHCSNLVELPSIGNAINLRELVLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLKLPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDRLVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLIEFPHVLDIITNLVLSDKDLQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTRQAVLPGREV

HMMPanther: PTHR23155
10-414 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LHNLRQMDLSYSVNLKELPDLSTAINLRKLFLSGCSSLIKLPSCIGNATNLEDLDLNGCSSLVELPSFGDAINLQKLLLRHCSNLVELPSIGNAINLRELVLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLKLPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDRLVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLIEFPHVLDIITNLVLSDKDLQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKLNQEARDLIIQTPTRQAVLPGREV

superfamily: SSF52058
11-264 SSF52058,LRR

HNLRQMDLSYSVNLKELPDLSTAINLRKLFLSGCSSLIKLPSCIGNATNLEDLDLNGCSSLVELPSFGDAINLQKLLLRHCSNLVELPSIGNAINLRELVLYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPSSIGNAINLQNLLLDDCSSLLKLPSSIGNATNLVYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDRLVLNDCSMLKRFP

HMMPfam: PF00560
IPR001611
35-54 LRR_1
Leucine-rich repeat

NLRKLFLSGCSSLIKLPSCI

HMMPfam: PF13504
58-75 LRR_7,Leucine rich repeat

TNLEDLDLNGCSSLVELP

HMMPfam: PF00560
IPR001611
82-102 LRR_1
Leucine-rich repeat

NLQKLLLRHCSNLVELPSIGN

HMMPfam: PF00560
IPR001611
129-150 LRR_1
Leucine-rich repeat

NLLILDLNGCSNLLELPSSIGN

HMMPfam: PF00560
IPR001611
153-174 LRR_1
Leucine-rich repeat

NLQKLDLRRCAKLLELPSSIGN

HMMPfam: PF00560
IPR001611
201-223 LRR_1
Leucine-rich repeat

NLVYMNLSNCSNLVELPLSIGNL

Gene3D: G3DSA:3.80.10.10
203-375 G3DSA:3.80.10.10

VYMNLSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDRLVLNDCSMLKRFPEISTNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLIEFPHVLDIITNLVLSDKDLQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCS

superfamily: SSF52058
268-391 SSF52058,LRR

TNVRALYLCGTAIEEVPLSIRSWPRLDELLMSYFDNLIEFPHVLDIITNLVLSDKDLQEVPPLIKRISRLQTLILKGYRKVVSLPQIPDSLKWIDAEDCESLERLDCSFHNPEITLFFGKCFKL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox