PRGDB00044884 (At4g26090)

From PRG Wiki
Jump to: navigation, search
At4g26090
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108740212 (DQ527957)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype KZ9 disease resistance protein (At4g26090) gene, partial cds.

DNA Sequence

ACTGACAACACTGATGCTCCAACAGAACAGCTCTTTGAAGAAGATTCCAACAGGGTTTTTCATGCATATGCCTGTTCTCAGAGTCTTGGACTTGTCGTTCACAAGTATCACTGAGATTCCGTTGTCTATCAAGTATTTGGTGGAGTTGTATCATCTGTCTATGTCAGGAACAAAGATAAGTGTATTGCCACAGGAGCTTGGGAATCTTAGAAAACTGAAGCATCTGGACCTACAAAGAACTCAGTTTCTTCAGACGATCCCACGAGATGCCATATGTTGGCTGAGCAAGCTCGAGGTTCTGAACTTGTACTACAGTTACGCCGGTTGGGAACTGCAGAGCTTTGGAGAAGATGAAGCAGAAGAACTCGGATTCGCTGACTTGGAATACTTGGAAAACCTAACCACACTCGGTATCACTGTTCTCTCATTGGAGACCCTAAAAACTCTCTTCGAGTTCGGTGCTTTGCATAAACATATACAGCATCTCCACGTTGAAGAGTGCAATGATCTCCTCTACTTCAATCTCCCATCACTCACTAACCATGGCAGGAACCTGAGAAGACTTAGCATTAAAAGTTGCCATGACTTGGAGTACCTGGTCACACCCGCAGATTTTGAAAATGATTGGCTTCCGAGTCTAGAGGTTCTGACGTTACACAGCCTTCACAACTTAACCAGAGTGTGGGGAAATTCTGTAAGCCAAGATTGTCTGCGGAATATCCGTTGCATAAACATTTCACACTGCAACAAGCTGAAGAATGTCTCATGGGTTCAGAAACTCCC


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLP


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF105
1-261 PTHR23155:SF105,RPS2 (RESISTANT TO P. SYRINGAE 2)

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLP

HMMPfam: PF13855
1-59 LRR_8,Leucine rich repeat

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKI

Gene3D: G3DSA:3.80.10.10
1-103 G3DSA:3.80.10.10

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLY

HMMPanther: PTHR23155
1-261 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLP

superfamily: SSF52058
1-261 SSF52058,LRR

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLP

HMMPfam: PF00560
IPR001611
71-91 LRR_1
Leucine-rich repeat

KLKHLDLQRTQFLQTIPRDAI

Gene3D: G3DSA:3.80.10.10
127-255 G3DSA:3.80.10.10

LEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVS


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox