PRGDB00044899 (At4g26090)

From PRG Wiki
Jump to: navigation, search
At4g26090
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108740181 (DQ527941)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Fab-2 disease resistance protein (At4g26090) gene, partial cds.

DNA Sequence

ACTGACAACACTGATGCTCCAACAGAACAGCTCTTTGAAGAAGATTCCAACAGGGTTTTTCATGCATATGCCTGTTCTCAGAGTCTTGGACTTGTCGTTCACAAGTATCACTGAGATTCCGTTGTCTATCAAGTATTTGGTGGAGTTGTATCATCTGTCTATGTCAGGAACAAAGATAAGTGTATTGCCACAGGAGCTTGGGAATCTTAGAAAACTGAAGCATCTGGACCTACAAAGAACTCAGTTTCTTCAGACGATCCCACGAGATGCCATATGTTGGCTGAGCAAGCTCGAGGTTCTGAACTTGTACTACAGTTACGCCGGTTGGGAACTGCAGAGCTTTGGAGAAGATGAAGCAGAAGAACTCGGATTCGCTGACTTGGAATACTTGGAAAACCTAACCACACTCGGTATCACTGTTCTCTCATTGGAGACCCTAAAAACTCTCTTCGAGTTCGGTGCTTTGCATAAACATATACAGCATCTCCACGTTGAAGAGTGCAATGATCTCCTCTACTTCAATCTCCCATCACTCACTAACCATGGCAGGAACCTGAGAAGACTTAGCATTAAAAGTTGCCATGACTTGGAGTACCTGGTCACACCCGCAGATTTTGAAAATGATTGGCTTCCGAGTCTAGAGGTTCTGACGTTACACAGCCTTCACAACTTAACCAGAGTGTGGGGAAATTCTGTAAGCCAAGATTGTCTGCGGAATATCCGTTGCATAAACATTTCACACTGCAACAAGCTGAAGAATGTCTCATGGGTTCAGAAACTCCC


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLP


Domains

Domain Start-End Description Sequence

HMMPfam: PF13855
1-59 LRR_8,Leucine rich repeat

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKI

superfamily: SSF52058
1-261 SSF52058,LRR

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLP

Gene3D: G3DSA:3.80.10.10
1-103 G3DSA:3.80.10.10

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLY

HMMPanther: PTHR23155
1-261 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLP

HMMPanther: PTHR23155:SF105
1-261 PTHR23155:SF105,RPS2 (RESISTANT TO P. SYRINGAE 2)

LTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLP

HMMPfam: PF00560
IPR001611
71-91 LRR_1
Leucine-rich repeat

KLKHLDLQRTQFLQTIPRDAI

Gene3D: G3DSA:3.80.10.10
127-255 G3DSA:3.80.10.10

LEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVS


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox