PRGDB00044945 (At4g14370)

From PRG Wiki
Jump to: navigation, search
At4g14370
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108740054 (DQ527804)
Gene Class Unknown
Domain Type LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Pu2-7 disease resistance protein (At4g14370) gene, partial cds.

DNA Sequence

GGAGTTTCCACCTCATCTACGGTTGCTTCGGTGGGAAGCATACCCGAGTAATGCTCTTCCTACTACATTTCATCCAGAATATCTTGTAGAACTTGATTTGAAGGAGAGCCAGCTTGAGAAGCTTTGGCAAGGAACACAGCCACTTACAAATCTCAAGAAAATGGATTTGACACGATCCTCTCATTTGAAGGAACTTCCAGATCTTTCAAATGCTACAAATCTCGAGAGGTTGGAGCTGAGTTATTGCAAGAGTTTGGTAGAGATTCCTTCCTCTTTTTCGGAACTTCGAAAACTAGAGACGTTGGTAATACACAACTGCACAAAGCTAGAAGTTGTTCCAACTCTCATCAACTTGGCATCTCTTGATTTCTTCAACATGCATGGTTGCTCCCAACTGAAAAAATTTCCAAATATTTCTACGCACATCTCAAGACTCGTTATAGATGACACATTGGTAGAAGAACTGCCTACATCAATAATACTTTGCACTCGGCTTAGGACTCTCATGATAAGCGGCAGTGGAAACTTTAAGACATTAACATATCTCCCTATGAGTCTAACGTATCTAGACCTAAGGTGTACGGGTATTGAGAAGATTCCAGATTG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

EFPPHLRLLRWEAYPSNALPTTFHPEYLVELDLKESQLEKLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCSQLKKFPNISTHISRLVIDDTLVEELPTSIILCTRLRTLMISGSGNFKTLTYLPMSLTYLDLRCTGIEKIPD


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-201 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EFPPHLRLLRWEAYPSNALPTTFHPEYLVELDLKESQLEKLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCSQLKKFPNISTHISRLVIDDTLVEELPTSIILCTRLRTLMISGSGNFKTLTYLPMSLTYLDLRCTGIEKIPD

HMMPanther: PTHR11017:SF20
1-201 PTHR11017:SF20,SUBFAMILY NOT NAMED

EFPPHLRLLRWEAYPSNALPTTFHPEYLVELDLKESQLEKLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCSQLKKFPNISTHISRLVIDDTLVEELPTSIILCTRLRTLMISGSGNFKTLTYLPMSLTYLDLRCTGIEKIPD

superfamily: SSF52058
2-201 SSF52058,LRR

FPPHLRLLRWEAYPSNALPTTFHPEYLVELDLKESQLEKLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCSQLKKFPNISTHISRLVIDDTLVEELPTSIILCTRLRTLMISGSGNFKTLTYLPMSLTYLDLRCTGIEKIPD

Gene3D: G3DSA:3.80.10.10
3-201 G3DSA:3.80.10.10

PPHLRLLRWEAYPSNALPTTFHPEYLVELDLKESQLEKLWQGTQPLTNLKKMDLTRSSHLKELPDLSNATNLERLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCSQLKKFPNISTHISRLVIDDTLVEELPTSIILCTRLRTLMISGSGNFKTLTYLPMSLTYLDLRCTGIEKIPD

HMMPfam: PF07725
IPR011713
27-46 LRR_3
Leucine-rich repeat 3

YLVELDLKESQLEKLWQGTQ

HMMPfam: PF13855
72-129 LRR_8,Leucine rich repeat

TNLERLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGC

HMMPfam: PF00560
IPR001611
185-201 LRR_1
Leucine-rich repeat

SLTYLDLRCTGIEKIPD


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox