PRGDB00044991 (At4g14370)

From PRG Wiki
Jump to: navigation, search
At4g14370
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108739961 (DQ527757)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype C24 disease resistance protein (At4g14370) gene, partial cds.

DNA Sequence

GGAGTTTCCACCTCATCTACGGTTGCTTCGGTGGGAAGCATACCCGAGTAATGCTCTTCCTACTACATTTCATCCAGAATATCTTGTAGAACTTGATTTGAAGGAGAGCCAGCTTGAGAAGCTTTGGCAAGGAACACAGCCACTTACAAATCTCAAGAAAATGGATTTGACACGATCCTTTCATTTGAAGGAACTTCCAGATCTTTCAAATGCTACAAATCTCGAGAGCTTGGAGCTGAGTTATTGCAAGAGTTTAGTAGAGATTCCTTCCTCTTTTTCGGAACTTCGAAAACTAGAGACGTTGGTAATACACAACTGCACAAAGCTAGAAGTTGTTCCAACTCTCATCAACTTGGCATCTCTTGATTTCTTCAACATGCATGGTTGCTCCCAACTGAAAAAATTTCCAGGTATTTCTACACACATCTCAAGACTCGTTATAGATGACACAGTGGTAGAAGAACTGCCTACATCAATAATACTTTGCACTCGTCTAAGGACTCTCATGATAAGCGGCAGTGGAAACTTTAAGACATTAACATATCTCCCTATGAGTCTAACGTATCTAGACCTAAGGTGTACGGGTATTGAGAAGATTCCAGATTG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

EFPPHLRLLRWEAYPSNALPTTFHPEYLVELDLKESQLEKLWQGTQPLTNLKKMDLTRSFHLKELPDLSNATNLESLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCSQLKKFPGISTHISRLVIDDTVVEELPTSIILCTRLRTLMISGSGNFKTLTYLPMSLTYLDLRCTGIEKIPD


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-201 PTHR11017:SF20,SUBFAMILY NOT NAMED

EFPPHLRLLRWEAYPSNALPTTFHPEYLVELDLKESQLEKLWQGTQPLTNLKKMDLTRSFHLKELPDLSNATNLESLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCSQLKKFPGISTHISRLVIDDTVVEELPTSIILCTRLRTLMISGSGNFKTLTYLPMSLTYLDLRCTGIEKIPD

HMMPanther: PTHR11017
1-201 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EFPPHLRLLRWEAYPSNALPTTFHPEYLVELDLKESQLEKLWQGTQPLTNLKKMDLTRSFHLKELPDLSNATNLESLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCSQLKKFPGISTHISRLVIDDTVVEELPTSIILCTRLRTLMISGSGNFKTLTYLPMSLTYLDLRCTGIEKIPD

superfamily: SSF52058
2-201 SSF52058,LRR

FPPHLRLLRWEAYPSNALPTTFHPEYLVELDLKESQLEKLWQGTQPLTNLKKMDLTRSFHLKELPDLSNATNLESLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCSQLKKFPGISTHISRLVIDDTVVEELPTSIILCTRLRTLMISGSGNFKTLTYLPMSLTYLDLRCTGIEKIPD

Gene3D: G3DSA:3.80.10.10
3-201 G3DSA:3.80.10.10

PPHLRLLRWEAYPSNALPTTFHPEYLVELDLKESQLEKLWQGTQPLTNLKKMDLTRSFHLKELPDLSNATNLESLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGCSQLKKFPGISTHISRLVIDDTVVEELPTSIILCTRLRTLMISGSGNFKTLTYLPMSLTYLDLRCTGIEKIPD

HMMPfam: PF07725
IPR011713
27-46 LRR_3
Leucine-rich repeat 3

YLVELDLKESQLEKLWQGTQ

HMMPfam: PF13855
72-129 LRR_8,Leucine rich repeat

TNLESLELSYCKSLVEIPSSFSELRKLETLVIHNCTKLEVVPTLINLASLDFFNMHGC

HMMPfam: PF00560
IPR001611
185-201 LRR_1
Leucine-rich repeat

SLTYLDLRCTGIEKIPD


List of References

Erica G Bakker, Christopher Toomajian, Martin Kreitman, Joy Bergelson
A genome-wide survey of R gene polymorphisms in Arabidopsis.
Plant Cell: 2006, 18(8);1803-18
PubMed:16798885 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox