PRGDB00045124 (At2g16870)

From PRG Wiki
Jump to: navigation, search
At2g16870
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108739623 (DQ527545)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Mt-0 disease resistance protein (At2g16870) gene, partial cds.

DNA Sequence

TCTTAAGAAGATGGATTTGTCAAGATCAGTTCATTTGAAGGAACTCCCAGATCTTTCAAATGCTACAAACCTGGAGAGACTGGAACTATGTGATTGCAGGGCTTTGGTAGAGCTTCCAAAGTCTATTGGGAATCTTCATAAACTAGAGAACTTAGTGATGGCTAACTGCATAAGTCTAGAAGTCATACCAACTCACATCAACTTGGCATCTCTTGAGCATATCACCATGACTGGATGCTCACGACTGAAAACATTTCCAGATTTTTCTACAAACATTGAGAGACTCCTTCTAATCGGCACATCGGTAGAAGAAGTGCCTGCATCAATCAGGCATTGGTCTTCTCTTTCGGATTTTTGTATAAAAAACAATGAAGATCTTAAGAGCTTAACATATTTTCCAGAGAAGGTAGAGCTGCTAGATCTAAGCTATACTGATATTGAGAAGATTCCAGATTGCATCAAAGGTTTTCATGGGCTAAAGTCTCTTGATGTAGCCGGCTGCAGAAAACTCACATCATTGCCTGAGCTCCCTATGTCACTCGG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

LKKMDLSRSVHLKELPDLSNATNLERLELCDCRALVELPKSIGNLHKLENLVMANCISLEVIPTHINLASLEHITMTGCSRLKTFPDFSTNIERLLLIGTSVEEVPASIRHWSSLSDFCIKNNEDLKSLTYFPEKVELLDLSYTDIEKIPDCIKGFHGLKSLDVAGCRKLTSLPELPMSLG


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-180 SSF52058,LRR

LKKMDLSRSVHLKELPDLSNATNLERLELCDCRALVELPKSIGNLHKLENLVMANCISLEVIPTHINLASLEHITMTGCSRLKTFPDFSTNIERLLLIGTSVEEVPASIRHWSSLSDFCIKNNEDLKSLTYFPEKVELLDLSYTDIEKIPDCIKGFHGLKSLDVAGCRKLTSLPELPMSL

HMMPanther: PTHR11017:SF20
1-180 PTHR11017:SF20,SUBFAMILY NOT NAMED

LKKMDLSRSVHLKELPDLSNATNLERLELCDCRALVELPKSIGNLHKLENLVMANCISLEVIPTHINLASLEHITMTGCSRLKTFPDFSTNIERLLLIGTSVEEVPASIRHWSSLSDFCIKNNEDLKSLTYFPEKVELLDLSYTDIEKIPDCIKGFHGLKSLDVAGCRKLTSLPELPMSL

Gene3D: G3DSA:3.80.10.10
1-178 G3DSA:3.80.10.10

LKKMDLSRSVHLKELPDLSNATNLERLELCDCRALVELPKSIGNLHKLENLVMANCISLEVIPTHINLASLEHITMTGCSRLKTFPDFSTNIERLLLIGTSVEEVPASIRHWSSLSDFCIKNNEDLKSLTYFPEKVELLDLSYTDIEKIPDCIKGFHGLKSLDVAGCRKLTSLPELPM

HMMPanther: PTHR11017
1-180 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LKKMDLSRSVHLKELPDLSNATNLERLELCDCRALVELPKSIGNLHKLENLVMANCISLEVIPTHINLASLEHITMTGCSRLKTFPDFSTNIERLLLIGTSVEEVPASIRHWSSLSDFCIKNNEDLKSLTYFPEKVELLDLSYTDIEKIPDCIKGFHGLKSLDVAGCRKLTSLPELPMSL

HMMPfam: PF00560
IPR001611
23-45 LRR_1
Leucine-rich repeat

NLERLELCDCRALVELPKSIGNL

HMMPfam: PF13504
158-174 LRR_7,Leucine rich repeat

GLKSLDVAGCRKLTSLP


List of References

Erica G Bakker, Christopher Toomajian, Martin Kreitman, Joy Bergelson
A genome-wide survey of R gene polymorphisms in Arabidopsis.
Plant Cell: 2006, 18(8);1803-18
PubMed:16798885 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox