PRGDB00045179 (At1g65850)

From PRG Wiki
Jump to: navigation, search
At1g65850
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108739480 (DQ527486)
Gene Class TNL
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Sorbo disease resistance protein (At1g65850) gene, partial cds.

DNA Sequence

CCTTAAGTGGATGTATTTGAATCATTCGAAAATCCTAAAGGAGCTACCTGATCTCTCAACAGCCACGAACCTTCAAGAACTATTTCTCGTTAAATGCTCAAGTTTGGTGGAGCTCCCATCCTCTATCGGAAAAGCCACTAATCTCCAGAAACTGTATCTTAATATGTGCACGAGTTTGGTGGAGCTGCCCTCTTCTATTGGGAACCTTCATAAGTTACAAAAATTGACTTTGAATGGATGCTCAAAGCTAGAGGTTCTTCCAGCTAACATCAACTTGGAATCTCTTGATGAACTTGATCTCACTGATTGCTTGGTGTTGAAAAGATTTCCTGAGATCTCTACAAACATTAAAGTTCTCAAGCTCTTAAGAACTACAATAAAAGAAGTCCCTTCGTCAATTAAGTCATGGCCTCGTCTTCGCGATTTGGAATTGTCATACAATCAAAACCTCAAAGGATTCATGCATGCTCTTGATATCATCACGACGATGTACTTTAACGATATAGAAATGCAAGAAATTCCTTTGTGGGTCAAGAAAATCTCTAGGCTTCAGACACTTATACTCAACGGATGTAAGAAGCTGGTATCACTCCCACAGCTTCCGGATTCCTTATC


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

LKWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLS


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-204 SSF52058,LRR

LKWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSL

Gene3D: G3DSA:3.80.10.10
3-203 G3DSA:3.80.10.10

WMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDS

HMMPanther: PTHR23155:SF298
20-204 PTHR23155:SF298

TATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSL

HMMPanther: PTHR23155
20-204 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLTLNGCSKLEVLPANINLESLDELDLTDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSIKSWPRLRDLELSYNQNLKGFMHALDIITTMYFNDIEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSL

HMMPfam: PF00560
IPR001611
47-69 LRR_1
Leucine-rich repeat

NLQKLYLNMCTSLVELPSSIGNL

HMMPfam: PF13504
70-87 LRR_7,Leucine rich repeat

HKLQKLTLNGCSKLEVLP

HMMPfam: PF13504
137-151 LRR_7,Leucine rich repeat

PRLRDLELSYNQNLK

HMMPfam: PF13504
181-198 LRR_7,Leucine rich repeat

SRLQTLILNGCKKLVSLP


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox