PRGDB00045443 (At1g59620)

From PRG Wiki
Jump to: navigation, search
At1g59620
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108738841 (DQ526951)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Kas-1 disease resistance protein (At1g59620) gene, partial cds.

DNA Sequence

CGAGGAGCTTGGTGGTTATAGGGGATTCGAAGTATGGTTTACGAGGCTACAGTTGATGAGGGTTTTAGATCTCCATGGAGTTGAGTTTGGAGGGGAGTTACCCTCTAGCATCGGACTGCTAATCCACTTGAGATATTTGAGTTTATATCGGGCAAAAGCATCTCATCTACCTTCGTCTATGCGGAATTTGAATATGCTGCTCTATTTAAACCTATGTGTACAAGAGAGTTGTTACATTTACATTCCCAATTTCTTGAAAGAGATGCTAGAGCTGAAATACCTCTCTCTCCCACTAAGAATGGATGATAAGGTAAAACTAGAATTGGGTAATCTAGTCAACCTGGAGAAGTTGGAAAATTTCTCAACAGAGCATGGGGGAGTGGGGGATCTTCAGTTTATGACCCGGCTTAGAGCCCTCTCTATCTATATCAGAGGCAGGTTGACTATGAAAACTCTATCTTCATCTCTAAGTAAACTGAGAGACTTGGAAAATCTTACAATCTGTTATTACCCGATGTATGCTCCCATGAGTGGTATAGAAGGATTAGTTTTGGACTGCGATCAGCTCAAGCATCTGAATTTGAGAATATATATGCCAAGGTTACCTGATGAACAACATTTTCCTTGGCATCTTCGAAACATATCTCTAGCTGAGTGTTGTTTGAAGGAGGATCCAATGCCGATTTTAGAGAAGCTGCTTCAATTAAACGAGGTCAGTTTATCTCATCAATCTTTCTGTGGGAAGAGAATGGTTTGCTCGGATGGTGGGTTTCCTCAATTGCAAAAGCTCGATTTGTGTGGACTGGAGGAGTGGGAAGAGTGGATAGTCGAAGAAGGCTCCATGCCACTTCTTCATAAGCTGACTATCCGCAACGATTCTAAATTAAAGGAGCTTCCTGATGGGTTGAAATTTATCACTTCCTTGAAAGAAGTGCATGTCATCTTAAATAATTGGGACTTTAAGAAGAAACTGTCCAGGGGAGGAGAAGATTACTACAAAGTCCAACACATTCCTCTTGTTCGATTTCT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

EELGGYRGFEVWFTRLQLMRVLDLHGVEFGGELPSSIGLLIHLRYLSLYRAKASHLPSSMRNLNMLLYLNLCVQESCYIYIPNFLKEMLELKYLSLPLRMDDKVKLELGNLVNLEKLENFSTEHGGVGDLQFMTRLRALSIYIRGRLTMKTLSSSLSKLRDLENLTICYYPMYAPMSGIEGLVLDCDQLKHLNLRIYMPRLPDEQHFPWHLRNISLAECCLKEDPMPILEKLLQLNEVSLSHQSFCGKRMVCSDGGFPQLQKLDLCGLEEWEEWIVEEGSMPLLHKLTIRNDSKLKELPDGLKFITSLKEVHVILNNWDFKKKLSRGGEDYYKVQHIPLVRFL

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
5-319 SSF52058,LRR

GYRGFEVWFTRLQLMRVLDLHGVEFGGELPSSIGLLIHLRYLSLYRAKASHLPSSMRNLNMLLYLNLCVQESCYIYIPNFLKEMLELKYLSLPLRMDDKVKLELGNLVNLEKLENFSTEHGGVGDLQFMTRLRALSIYIRGRLTMKTLSSSLSKLRDLENLTICYYPMYAPMSGIEGLVLDCDQLKHLNLRIYMPRLPDEQHFPWHLRNISLAECCLKEDPMPILEKLLQLNEVSLSHQSFCGKRMVCSDGGFPQLQKLDLCGLEEWEEWIVEEGSMPLLHKLTIRNDSKLKELPDGLKFITSLKEVHVILNNWD

HMMPanther: PTHR23155
10-322 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EVWFTRLQLMRVLDLHGVEFGGELPSSIGLLIHLRYLSLYRAKASHLPSSMRNLNMLLYLNLCVQESCYIYIPNFLKEMLELKYLSLPLRMDDKVKLELGNLVNLEKLENFSTEHGGVGDLQFMTRLRALSIYIRGRLTMKTLSSSLSKLRDLENLTICYYPMYAPMSGIEGLVLDCDQLKHLNLRIYMPRLPDEQHFPWHLRNISLAECCLKEDPMPILEKLLQLNEVSLSHQSFCGKRMVCSDGGFPQLQKLDLCGLEEWEEWIVEEGSMPLLHKLTIRNDSKLKELPDGLKFITSLKEVHVILNNWDFKK

HMMPanther: PTHR23155:SF240
10-322 PTHR23155:SF240,CW9

EVWFTRLQLMRVLDLHGVEFGGELPSSIGLLIHLRYLSLYRAKASHLPSSMRNLNMLLYLNLCVQESCYIYIPNFLKEMLELKYLSLPLRMDDKVKLELGNLVNLEKLENFSTEHGGVGDLQFMTRLRALSIYIRGRLTMKTLSSSLSKLRDLENLTICYYPMYAPMSGIEGLVLDCDQLKHLNLRIYMPRLPDEQHFPWHLRNISLAECCLKEDPMPILEKLLQLNEVSLSHQSFCGKRMVCSDGGFPQLQKLDLCGLEEWEEWIVEEGSMPLLHKLTIRNDSKLKELPDGLKFITSLKEVHVILNNWDFKK

Gene3D: G3DSA:3.80.10.10
13-97 G3DSA:3.80.10.10

FTRLQLMRVLDLHGVEFGGELPSSIGLLIHLRYLSLYRAKASHLPSSMRNLNMLLYLNLCVQESCYIYIPNFLKEMLELKYLSLP

Gene3D: G3DSA:3.80.10.10
146-319 G3DSA:3.80.10.10

RLTMKTLSSSLSKLRDLENLTICYYPMYAPMSGIEGLVLDCDQLKHLNLRIYMPRLPDEQHFPWHLRNISLAECCLKEDPMPILEKLLQLNEVSLSHQSFCGKRMVCSDGGFPQLQKLDLCGLEEWEEWIVEEGSMPLLHKLTIRNDSKLKELPDGLKFITSLKEVHVILNNWD


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox