PRGDB00045473 (At1g53350)

From PRG Wiki
Jump to: navigation, search
At1g53350
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108738743 (DQ526829)
Gene Class CNL
Domain Type LRR, NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Ts-1 disease resistance protein (At1g53350) gene, partial cds.

DNA Sequence

GCTTAGAGTGTTAGATCTTTCTTACGTACAGTTTGAAGGAGGGAAGTTACCATCCAGCATTGGAGATCTCATTCACTTGAGATTCTTGAGCTTATACGAGGCTGGAGTATCTCATCTACCTTCTTCTCTGGGGAATCTAAAGCTTCTGCTCTGTTTGAACTTAGGTGTTGCTGATCGGTTACTAGTTCATGTGCCAAATGTTTTGAAAGAGATGCAAGAACTGAGGTACCTTCGCTTACCTCGTTCAATGCCTGCTAAAACCAAGTTGGAATTAGGTGATCTAGTGAACTTAGAGTCGTTGACGAATTTCTCAACGAAACACGGTAGTGTGACGGACCTCCTCCGTATGACTAAGCTCACGGTTCTCAACGTGATTTTCAGTGGCGAGTGTACTTTCGAAACTCTATTGTTATCTCTTCGTGAGTTGAGAAATCTCGAGACGCTTAGTTTTCATGATTTCCAAAAAGTCAGCGTGGCAAATCATGGGGGAGAGCTCCTCGTTCTTGATTTTATTCATCTAAAGGATTTAACATTGTCAATGCATCTGCCAAGGTTTCCGGATCAATACCGATTCCCTCCTCACCTTGCCCACATATGGCTAATCGGATGCCGCATGGAGGAAGATCCAATGCCGATTCTAGAGAAGTTGCTTCATTTGAAATCGGTTTATCTTTCATCCGGTGCATTCTTGGGAAGGAGAATGGTGTGCTCGAAAGGCGGATTTCCTCAACTACTTGCTCTAAAAATGTCGTATAAAAAAGAGTTGGTAGAGTGGAGAGTAGAAGAAGGGTCGATGCCATGTCTTCGTACTCTGACTATAGACAATTGCAAGAAGTTGAAGCAACTTCCGGATGGGCTCAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

LRVLDLSYVQFEGGKLPSSIGDLIHLRFLSLYEAGVSHLPSSLGNLKLLLCLNLGVADRLLVHVPNVLKEMQELRYLRLPRSMPAKTKLELGDLVNLESLTNFSTKHGSVTDLLRMTKLTVLNVIFSGECTFETLLLSLRELRNLETLSFHDFQKVSVANHGGELLVLDFIHLKDLTLSMHLPRFPDQYRFPPHLAHIWLIGCRMEEDPMPILEKLLHLKSVYLSSGAFLGRRMVCSKGGFPQLLALKMSYKKELVEWRVEEGSMPCLRTLTIDNCKKLKQLPDGL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-286 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LRVLDLSYVQFEGGKLPSSIGDLIHLRFLSLYEAGVSHLPSSLGNLKLLLCLNLGVADRLLVHVPNVLKEMQELRYLRLPRSMPAKTKLELGDLVNLESLTNFSTKHGSVTDLLRMTKLTVLNVIFSGECTFETLLLSLRELRNLETLSFHDFQKVSVANHGGELLVLDFIHLKDLTLSMHLPRFPDQYRFPPHLAHIWLIGCRMEEDPMPILEKLLHLKSVYLSSGAFLGRRMVCSKGGFPQLLALKMSYKKELVEWRVEEGSMPCLRTLTIDNCKKLKQLPDGL

Gene3D: G3DSA:3.80.10.10
1-94 G3DSA:3.80.10.10

LRVLDLSYVQFEGGKLPSSIGDLIHLRFLSLYEAGVSHLPSSLGNLKLLLCLNLGVADRLLVHVPNVLKEMQELRYLRLPRSMPAKTKLELGDL

HMMPanther: PTHR23155:SF231
1-286 PTHR23155:SF231,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LRVLDLSYVQFEGGKLPSSIGDLIHLRFLSLYEAGVSHLPSSLGNLKLLLCLNLGVADRLLVHVPNVLKEMQELRYLRLPRSMPAKTKLELGDLVNLESLTNFSTKHGSVTDLLRMTKLTVLNVIFSGECTFETLLLSLRELRNLETLSFHDFQKVSVANHGGELLVLDFIHLKDLTLSMHLPRFPDQYRFPPHLAHIWLIGCRMEEDPMPILEKLLHLKSVYLSSGAFLGRRMVCSKGGFPQLLALKMSYKKELVEWRVEEGSMPCLRTLTIDNCKKLKQLPDGL

superfamily: SSF52058
1-283 SSF52058,LRR

LRVLDLSYVQFEGGKLPSSIGDLIHLRFLSLYEAGVSHLPSSLGNLKLLLCLNLGVADRLLVHVPNVLKEMQELRYLRLPRSMPAKTKLELGDLVNLESLTNFSTKHGSVTDLLRMTKLTVLNVIFSGECTFETLLLSLRELRNLETLSFHDFQKVSVANHGGELLVLDFIHLKDLTLSMHLPRFPDQYRFPPHLAHIWLIGCRMEEDPMPILEKLLHLKSVYLSSGAFLGRRMVCSKGGFPQLLALKMSYKKELVEWRVEEGSMPCLRTLTIDNCKKLKQLP

Gene3D: G3DSA:3.80.10.10
95-277 G3DSA:3.80.10.10

VNLESLTNFSTKHGSVTDLLRMTKLTVLNVIFSGECTFETLLLSLRELRNLETLSFHDFQKVSVANHGGELLVLDFIHLKDLTLSMHLPRFPDQYRFPPHLAHIWLIGCRMEEDPMPILEKLLHLKSVYLSSGAFLGRRMVCSKGGFPQLLALKMSYKKELVEWRVEEGSMPCLRTLTIDNCK


List of References

Erica G Bakker, Christopher Toomajian, Martin Kreitman, Joy Bergelson
A genome-wide survey of R gene polymorphisms in Arabidopsis.
Plant Cell: 2006, 18(8);1803-18
PubMed:16798885 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox