PRGDB00046105 (At5g04720)

From PRG Wiki
Jump to: navigation, search
At5g04720
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 104646814 (DQ528137)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Mz-0 disease resistance protein (At5g04720) gene, partial cds.

DNA Sequence

CCCTAAGGCTGAAGTTTTGATACTACACTTCTCTTCTGACAAGTATGTATTGCCTCCTTTCATTGCTAAGATGGGCAAGCTTACAGCGCTCGTGATCATCAACAATGGTATGTCTCCTGCGCGTCTACATGACTTCTCCATCTTTACCAATTTGGCCAAACTCAAGAGTCTCTGGCTTCAGAGGGTTCATGTCCCTGAACTCTCTAGCAGTACAGTGCCCTTGCAAAACCTCCACAAGCTGTCTCTCATATTCTGCAAGATCAACACTAGTCTTGATCAGACAGAGCTAGACATTGCCCAAATCTTCCCAAAATTGTCTGATCTTACAATAGATCATTGTGATGATCTTCTGGAACTACCTTCGACCATCTGTGGAATCACCTCTCTCAATTCCATCAGCATAACAAATTGTCCCCGCATCAAGGAATTGCCTAAGAATCTGAGTAAGCTAAAAGCCCTTCAGCTTCTGAGGCTATACGCTTGCCATGAGCTGAATTCTCTGCCTGTGGAAATCTGTGAACTGCCAAGACTAAAGTATGTTGACATTTCTCAATGTGTCAGCCTGAGTTCTCTTCCGGAAAAGATAGGAAAGGTAAAGACACTTGAGAAAATCGACACGAGGGAATGCAGCTTATCGAGCATACCAAACTCTGTGGTTTTATTGACTTCTCTACGCCATGTAATATGCGATAGAGAGGCTTTATGGATGTGGGAAAAGGTCCA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

PKAEVLILHFSSDKYVLPPFIAKMGKLTALVIINNGMSPARLHDFSIFTNLAKLKSLWLQRVHVPELSSSTVPLQNLHKLSLIFCKINTSLDQTELDIAQIFPKLSDLTIDHCDDLLELPSTICGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYACHELNSLPVEICELPRLKYVDISQCVSLSSLPEKIGKVKTLEKIDTRECSLSSIPNSVVLLTSLRHVICDREALWMWEKV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
8-236 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LHFSSDKYVLPPFIAKMGKLTALVIINNGMSPARLHDFSIFTNLAKLKSLWLQRVHVPELSSSTVPLQNLHKLSLIFCKINTSLDQTELDIAQIFPKLSDLTIDHCDDLLELPSTICGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYACHELNSLPVEICELPRLKYVDISQCVSLSSLPEKIGKVKTLEKIDTRECSLSSIPNSVVLLTSLRHVICDREALWM

HMMPanther: PTHR23155:SF282
8-236 PTHR23155:SF282,SUBFAMILY NOT NAMED

LHFSSDKYVLPPFIAKMGKLTALVIINNGMSPARLHDFSIFTNLAKLKSLWLQRVHVPELSSSTVPLQNLHKLSLIFCKINTSLDQTELDIAQIFPKLSDLTIDHCDDLLELPSTICGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYACHELNSLPVEICELPRLKYVDISQCVSLSSLPEKIGKVKTLEKIDTRECSLSSIPNSVVLLTSLRHVICDREALWM

Gene3D: G3DSA:3.80.10.10
14-227 G3DSA:3.80.10.10

KYVLPPFIAKMGKLTALVIINNGMSPARLHDFSIFTNLAKLKSLWLQRVHVPELSSSTVPLQNLHKLSLIFCKINTSLDQTELDIAQIFPKLSDLTIDHCDDLLELPSTICGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYACHELNSLPVEICELPRLKYVDISQCVSLSSLPEKIGKVKTLEKIDTRECSLSSIPNSVVLLTSLRHV

superfamily: SSF52047
16-231 SSF52047,LRR

VLPPFIAKMGKLTALVIINNGMSPARLHDFSIFTNLAKLKSLWLQRVHVPELSSSTVPLQNLHKLSLIFCKINTSLDQTELDIAQIFPKLSDLTIDHCDDLLELPSTICGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYACHELNSLPVEICELPRLKYVDISQCVSLSSLPEKIGKVKTLEKIDTRECSLSSIPNSVVLLTSLRHVICDR


List of References

Erica G Bakker, Christopher Toomajian, Martin Kreitman, Joy Bergelson
A genome-wide survey of R gene polymorphisms in Arabidopsis.
Plant Cell: 2006, 18(8);1803-18
PubMed:16798885 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox