PRGDB00046298 (At4g14610)

From PRG Wiki
Jump to: navigation, search
At4g14610
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 104646377 (DQ527852)
Gene Class T
Domain Type LRR, LRR, LRR, TIR, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Fab-2 disease resistance protein (At4g14610) gene, partial cds.

DNA Sequence

GAAGAACTGGAGAGCTGTGAGAAGAATGTCGTTGATGAAAAATGAGCTTGAAAAGATTTTGGGTTGCCCTACATGTCCTCAACTTACAACTCTCCTCCTCCAAAAAAACCACAAATTGGTAAATATTTCAGGAGAATTCTTTCGATTCATGCCTAACCTTGTGGTATTGGATTTATCATGGAATAGTAGTCTCACTGGATTACCAAAGAAAATATCAGAGTTGGTCTCCTTGCGATATCTTGACTTGTCATATACAAACATCGAAAGATTGCCTGTTGGTTTACAAGAGTTGAAACAACTAATACATCTGAATTTGGAGTCTATGAAGAGTTTGGAGAGTATTGCTGGGGTATCTAAGTTGTTGAGTTTGAAGACACTGAGACTACAAAAGTCCAAAAAGGCTCTAGATGTGAACTCAGCGAAGGAGCTACAACTCTTAGAACATATAGAAGTTCTAACCATAGATATCTTTTCAAGTTTGGTTTTGGAACATTTGTTATGCTCTCAGAGATTGGCGAAATCTATTCAATATGTAGAGCTTATAGAGGTTGAGGAAGAATCTTTCAAAATATTAACTTTTCCAAGCATGTGTAATATCCGTCGAATTGGCATATGGAAGTGTGGAATGAAGGAGATAAAGGTCGAGATGAGAACATCATCATGCTTCTCTAGCCTCTCCAAAGTCTTTATAGGACAATGTGATGGTCTAAAGGAGTTGACATGGCTATTGTTTGCTCCAAACCTTACTTATCTCGACGCTCGTTTCGCAGAGCAACTTGAGGATATAATCAGTGAAGAAAAAGCTGCAAGTGTTACGGACGAGAATGCAAGTATTATCATTCCTTTTCAAAAACTAGAATGTCTTAGCTTATCTGATTTACCTAAGCTAAAGAGCATCTACTGGTCACCATTGTCTTTTCCACGTCTGAGTGAGCTTGCAGTGCAAGAACATTGTCCAAAGCTGAAAAAGCTTCCATTGAACTCCAAGAGTGGAACTGCAGGTGTAGAACTTGTCGTAAAATACGGCGAAAACAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

KNWRAVRRMSLMKNELEKILGCPTCPQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISELVSLRYLDLSYTNIERLPVGLQELKQLIHLNLESMKSLESIAGVSKLLSLKTLRLQKSKKALDVNSAKELQLLEHIEVLTIDIFSSLVLEHLLCSQRLAKSIQYVELIEVEEESFKILTFPSMCNIRRIGIWKCGMKEIKVEMRTSSCFSSLSKVFIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNSKSGTAGVELVVKYGEN


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-328 SSF52058,LRR

KNWRAVRRMSLMKNELEKILGCPTCPQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISELVSLRYLDLSYTNIERLPVGLQELKQLIHLNLESMKSLESIAGVSKLLSLKTLRLQKSKKALDVNSAKELQLLEHIEVLTIDIFSSLVLEHLLCSQRLAKSIQYVELIEVEEESFKILTFPSMCNIRRIGIWKCGMKEIKVEMRTSSCFSSLSKVFIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNS

HMMPanther: PTHR23155:SF108
4-343 PTHR23155:SF108,SUBFAMILY NOT NAMED

RAVRRMSLMKNELEKILGCPTCPQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISELVSLRYLDLSYTNIERLPVGLQELKQLIHLNLESMKSLESIAGVSKLLSLKTLRLQKSKKALDVNSAKELQLLEHIEVLTIDIFSSLVLEHLLCSQRLAKSIQYVELIEVEEESFKILTFPSMCNIRRIGIWKCGMKEIKVEMRTSSCFSSLSKVFIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNSKSGTAGVELVVKYGE

HMMPanther: PTHR23155
4-343 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RAVRRMSLMKNELEKILGCPTCPQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISELVSLRYLDLSYTNIERLPVGLQELKQLIHLNLESMKSLESIAGVSKLLSLKTLRLQKSKKALDVNSAKELQLLEHIEVLTIDIFSSLVLEHLLCSQRLAKSIQYVELIEVEEESFKILTFPSMCNIRRIGIWKCGMKEIKVEMRTSSCFSSLSKVFIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNSKSGTAGVELVVKYGE

Gene3D: G3DSA:3.80.10.10
9-152 G3DSA:3.80.10.10

MSLMKNELEKILGCPTCPQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISELVSLRYLDLSYTNIERLPVGLQELKQLIHLNLESMKSLESIAGVSKLLSLKTLRLQKSKKALDVNSAKELQLLEHIEVL

HMMPfam: PF13855
26-87 LRR_8,Leucine rich repeat

PQLTTLLLQKNHKLVNISGEFFRFMPNLVVLDLSWNSSLTGLPKKISELVSLRYLDLSYTNI

ProfileScan: PS51450
IPR001611
27-49 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLTTLLLQKNHKLVNISGEFFRF

ProfileScan: PS51450
IPR001611
52-74 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVVLDLSWNSSLTGLPKKISEL

ProfileScan: PS51450
IPR001611
76-98 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRYLDLSYTNIERLPVGLQELK

ProfileScan: PS51450
IPR001611
99-121 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLIHLNLESMKSLESIAGVSKLL

Gene3D: G3DSA:3.80.10.10
191-328 G3DSA:3.80.10.10

LTFPSMCNIRRIGIWKCGMKEIKVEMRTSSCFSSLSKVFIGQCDGLKELTWLLFAPNLTYLDARFAEQLEDIISEEKAASVTDENASIIIPFQKLECLSLSDLPKLKSIYWSPLSFPRLSELAVQEHCPKLKKLPLNS


List of References

Erica G Bakker, Christopher Toomajian, Martin Kreitman, Joy Bergelson
A genome-wide survey of R gene polymorphisms in Arabidopsis.
Plant Cell: 2006, 18(8);1803-18
PubMed:16798885 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox