PRGDB00046806 (At1g33560)

From PRG Wiki
Jump to: navigation, search
At1g33560
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 104645140 (DQ526675)
Gene Class Unknown
Domain Type LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Bil-7 disease resistance protein (At1g33560) gene, partial cds.

DNA Sequence

GATGAGTAGACTCAGGGTGCTCGTGATTATCAACAATGGCATGTCTCCTGCGCGTCTACATGGCTTCTCCATCTTTGCCAATTTGGCCAAACTGAGGAGTCTCTGGCTCAAGAGGGTACATGTCCCTGAACTCACCAGCTGCACCATTCCACTGAAAAACCTGCACAAGATGCATCTAATCTTTTGTAAGGTCAAGAACAGCTTTGTTCAGACGTCATTCGACATCTCGAAAATATTCCCAAGCTTGTCTGATCTCACTATTGATCACTGTGATGATCTTTTGGAACTAAAATCCATATTTGGAATAACCTCTCTCAACTCTCTCAGCATAACCAACTGTCCACGGATTCTTGAATTGCCCAAGAATTTGAGTAACGTACAGTCCCTTGAACGTCTAAGGTTATATGCCTGCCCCGAGCTGATATCCCTCCCGGTCGAAGTTTGTGAGCTGCCATGTCTAAAGTACGTTGACATTTCACAGTGTGTCAGCCTGGTTTCTCTTCCTGAAAAGTTTGGAAAGCTAGGGAGTCTTGAGAAAATTGACATGAGAGAATGCAGTTTATTGGGTTTACCAAGTTCTGTAGCTGCACTTGT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKMHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAALV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF764
1-191 PTHR24420:SF764

MSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKMHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLP

superfamily: SSF52058
1-197 SSF52058,LRR

MSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKMHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAAL

HMMPanther: PTHR24420
1-191 PTHR24420,FAMILY NOT NAMED

MSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKMHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLP

Gene3D: G3DSA:3.80.10.10
2-195 G3DSA:3.80.10.10

SRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKMHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVA

HMMPfam: PF00560
IPR001611
153-174 LRR_1
Leucine-rich repeat

LKYVDISQCVSLVSLPEKFGKL


List of References

Erica G Bakker, Christopher Toomajian, Martin Kreitman, Joy Bergelson
A genome-wide survey of R gene polymorphisms in Arabidopsis.
Plant Cell: 2006, 18(8);1803-18
PubMed:16798885 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox