PRGDB00046811 (At5g35450)

From PRG Wiki
Jump to: navigation, search
At5g35450
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 110742304 (AK227013)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana mRNA for disease resistance protein, complete cds, clone: RAFL09-45-H06.

DNA Sequence

ATGGCTGAAGGAGTTGTGTCGTTTGGAGTTCAGAAGCTTTGGGCGCTTCTTAATCGAGAATCCGAGCGATTGAATGGAATAGATGAGCAAGTTGATGGACTAAAGCGTCAGCTGAGAGGGTTACAGTCGCTGTTGAAAGATGCAGATGCAAAGAAACATGGAAGTGATAGGGTGAGGAACTTCTTGGAAGATGTCAAAGACCTTGTTTTTGATGCTGAGGATATAATTGAATCCTATGTTCTGAACAAACTTAGAGGAGAAGGAAAAGGGGTCAAGAATCATGTGAGACGACTTGCTTGCTTCTTGACGGATCGCCACAAGGTTGCTTCAGATATCGAGGGTATCACTAAAAGGATCTCTAAGGTGATTGGGGAAATGCAGAGTTTAGGGATACAACAACAAATCATTGATGGTGGTCGTTCGCTGTCTCTTCAGGACATACAGAGGGAGATCCGGCAAACGTTTCCTAACAGCTCTGAAAGCGATCTTGTCGGGGTGGAGCAAAGTGTTGAAGAATTGGTTGGTCCTATGGTGGAAATTGATAACATTCAAGTGGTTTCTATATCTGGGATGGGCGGTATTGGTAAAACCACTTTGGCCAGACAAATCTTTCATCATGATTTAGTCCGGCGTCATTTTGATGGATTCGCATGGGTCTGTGTTTCGCAACAATTTACTCAGAAGCATGTTTGGCAGAGAATCTTGCAAGAACTTCGGCCACACGATGGTGAGATCTTACAGATGGACGAATATACAATCCAGGGTAAACTCTTTCAGTTGTTGGAAACCGGTAGATATTTGGTTGTCCTCGATGATGTATGGAAAGAAGAAGACTGGGATCGAATAAAAGAAGTGTTTCCACGGAAAAGAGGTTGGAAGATGCTACTTACTTCTCGAAATGAAGGAGTTGGGTTACATGCTGATCCAACATGTTTATCTTTTAGAGCAAGAATCCTAAATCCCAAAGAAAGTTGGAAGCTCTTTGAGAGGATAGTCCCTAGAAGAAATGAAACTGAATATGAAGAAATGGAAGCCATCGGAAAGGAAATGGTCACATATTGTGGAGGACTACCATTAGCTGTTAAAGTTTTGGGAGGCTTGTTAGCTAATAAACATACAGCTAGTGAGTGGAAAAGAGTTAGTGAGAATATCGGAGCTCAAATCGTAGGAAAATCGTGCTTAGATGACAACAGTCTCAATTCGGTTTACCGAATATTGTCTTTGAGTTATGAAGATTTGCCAACAGATTTAAAGCATTGTTTCCTTTACCTAGCCCATTTCCCTGAAGATTACAAGATAAAGACACGGACATTGTACAGTTACTGGGCCGCAGAGGGAATTTACGATGGATTAACCATCCTTGATAGTGGAGAAGACTACCTAGAAGAACTAGTGAGGAGAAATTTGGTTATTGCTGAAAAGAGCAATTTGAGTTGGAGACTTAAACTTTGTCAAATGCATGACATGATGAGGGAAGTATGTATATCTAAAGCCAAAGTAGAGAACTTCCTCCAAATTATCAAAGTCCCTACTTCCACCTCTACCATCATTGCTCAATCTCCTAGTAGATCTCGAAGACTCACCGTACATAGTGGTAAAGCCTTTCATATACTAGGACACAAAAAAAAGGTCAGATCTCTTTTAGTTTTGGGACTCAAGGAAGATCTTTGGATACAATCAGCTTCACGCTTCCAAAGCTTACCATTGCTCAGGGTGTTGGATCTGTCTTCGGTAAAATTTGAAGGAGGGAAGTTACCTTCTAGCATTGGAGGGCTCATCCATTTGAGATTCTTGAGCTTACACCAAGCTGTGGTATCTCATCTACCTTCTACTATTCGGAATTTAAAGCTTATGCTCTATTTGAACTTACATGTTGCTATCGGGGTGCCGGTTCACGTGCCAAATGTTTTGAAAGAGATGCTAGAGTTGAGGTACCTTTCCCTACCTCTGGATATGCATGATAAAACCAAGTTGGAATTGGGTGATCTAGTGAACCTGGAGTACTTGTGGTGTTTCTCAACGCAACACAGTAGTGTGACAGACCTCCTCCGTATGACCAAGCTCAGGTTTTTCGGTGTATCTTTTAGTGAAAGGTGTACTTTTGAAAATCTATCTTCATCTCTCCGTCAATTTCGAAAGCTGGAGACACTTAGTTTCATTTATTCGCGCAAAACCTATATGGTTGATTATGTGGGAGAATTCGTTCTGGATTTTATTCATCTAAAGAAGTTAAGTTTGGGAGTACATTTGTCAAAGATTCCTGATCAACATCAATTACCTCCCCACATTGCACACATATATTTATTGTTTTGCCACATGGAGGAGGATCCAATGCCAATTCTAGAAAAGTTGCTTCATCTGAAGTCGGTTGAATTAAGACGCAAGGCTTTCATAGGGAGGAGAATGGTGTGCTCAAAAGGCGGGTTTCCTCAATTACGTGCTCTACAAATATCTGAACAATCGGAGTTGGAAGAGTGGATAGTAGAAGAAGGGTCGATGCCATGTCTTCGTGATTTAATTATACATAGTTGCGAAAAGTTGGAGGAACTTCCTGACGGACTCAAGTATGTAACATCCTTAAAGGAACTGAAGATTGAAGGAATGAAGAGGGAGTGGAAGGAGAAATTGGTTGGAGAAGATTACTACAAAGTCCAACACATTCCCGATGTTCAATTTTTCAACTGTGACGACGAACAAAGAGAATAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MAEGVVSFGVQKLWALLNRESERLNGIDEQVDGLKRQLRGLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKNHVRRLACFLTDRHKVASDIEGITKRISKVIGEMQSLGIQQQIIDGGRSLSLQDIQREIRQTFPNSSESDLVGVEQSVEELVGPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFPRKRGWKMLLTSRNEGVGLHADPTCLSFRARILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASEWKRVSENIGAQIVGKSCLDDNSLNSVYRILSLSYEDLPTDLKHCFLYLAHFPEDYKIKTRTLYSYWAAEGIYDGLTILDSGEDYLEELVRRNLVIAEKSNLSWRLKLCQMHDMMREVCISKAKVENFLQIIKVPTSTSTIIAQSPSRSRRLTVHSGKAFHILGHKKKVRSLLVLGLKEDLWIQSASRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLPLDMHDKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLRFFGVSFSERCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGMKREWKEKLVGEDYYKVQHIPDVQFFNCDDEQRE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF231
2-900 PTHR23155:SF231,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEGVVSFGVQKLWALLNRESERLNGIDEQVDGLKRQLRGLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKNHVRRLACFLTDRHKVASDIEGITKRISKVIGEMQSLGIQQQIIDGGRSLSLQDIQREIRQTFPNSSESDLVGVEQSVEELVGPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFPRKRGWKMLLTSRNEGVGLHADPTCLSFRARILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASEWKRVSENIGAQIVGKSCLDDNSLNSVYRILSLSYEDLPTDLKHCFLYLAHFPEDYKIKTRTLYSYWAAEGIYDGLTILDSGEDYLEELVRRNLVIAEKSNLSWRLKLCQMHDMMREVCISKAKVENFLQIIKVPTSTSTIIAQSPSRSRRLTVHSGKAFHILGHKKKVRSLLVLGLKEDLWIQSASRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLPLDMHDKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLRFFGVSFSERCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGMKREWKEKLVGEDYYKVQHIPDVQFFNCDDEQR

HMMPanther: PTHR23155
2-900 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEGVVSFGVQKLWALLNRESERLNGIDEQVDGLKRQLRGLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLRGEGKGVKNHVRRLACFLTDRHKVASDIEGITKRISKVIGEMQSLGIQQQIIDGGRSLSLQDIQREIRQTFPNSSESDLVGVEQSVEELVGPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFPRKRGWKMLLTSRNEGVGLHADPTCLSFRARILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASEWKRVSENIGAQIVGKSCLDDNSLNSVYRILSLSYEDLPTDLKHCFLYLAHFPEDYKIKTRTLYSYWAAEGIYDGLTILDSGEDYLEELVRRNLVIAEKSNLSWRLKLCQMHDMMREVCISKAKVENFLQIIKVPTSTSTIIAQSPSRSRRLTVHSGKAFHILGHKKKVRSLLVLGLKEDLWIQSASRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLPLDMHDKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLRFFGVSFSERCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGMKREWKEKLVGEDYYKVQHIPDVQFFNCDDEQR

superfamily: SSF52540
146-391 SSF52540

DIQREIRQTFPNSSESDLVGVEQSVEELVGPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFPRKRGWKMLLTSRNEGVGLHADPTCLSFRARILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASEWKRVSENIGAQIVGK

HMMPfam: PF00931
IPR002182
167-448 NB-ARC,NBS
NB-ARC

EQSVEELVGPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFPRKRGWKMLLTSRNEGVGLHADPTCLSFRARILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASEWKRVSENIGAQIVGKSCLDDNSLNSVYRILSLSYEDLPTDLKHCFLYLAHFPEDYKIKTRTLYSYWAAEGIY

Gene3D: G3DSA:3.40.50.300
175-287 G3DSA:3.40.50.300

GPMVEIDNIQVVSISGMGGIGKTTLARQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDGEILQMDEYTIQGKLFQLLETGRYLVVLDDVWKEEDWDRIKEVFP

FPrintScan: PR00364
IPR000767
185-200 DISEASERSIST
Disease resistance protein

VVSISGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
260-274 DISEASERSIST
Disease resistance protein

LLETGRYLVVLDDVW

FPrintScan: PR00364
IPR000767
354-368 DISEASERSIST
Disease resistance protein

CGGLPLAVKVLGGLL

superfamily: SSF52058
485-896 SSF52058,LRR

QMHDMMREVCISKAKVENFLQIIKVPTSTSTIIAQSPSRSRRLTVHSGKAFHILGHKKKVRSLLVLGLKEDLWIQSASRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLPLDMHDKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLRFFGVSFSERCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGMKREWKEKLVGEDYYKVQHIPDVQFFNCD

Gene3D: G3DSA:3.80.10.10
562-649 G3DSA:3.80.10.10

SRFQSLPLLRVLDLSSVKFEGGKLPSSIGGLIHLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLP

FPrintScan: PR00364
IPR000767
565-581 DISEASERSIST
Disease resistance protein

QSLPLLRVLDLSSVKFE

Gene3D: G3DSA:3.80.10.10
698-867 G3DSA:3.80.10.10

RCTFENLSSSLRQFRKLETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSKIPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox