PRGDB00046816 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 91806643 (DQ446810)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana clone pENTR221-At4g09360 disease resistance protein (At4g09360) mRNA, complete cds.

DNA Sequence

ATGGACGTTGACATGGAACGACTGAATCCTCTATTGAGCATCATGCGGTTTAGCCACATTGCAGATGGTACCCCCTTCCGTTGCATTAGCTTCTCAGGTTTCCAGTGCTTGGTAGAGTTGAATCTGATCAACTTAAACATCCAGAAAATCCCAGACAACATTGGTCTAATGCAGTCACTAGAGAAAGTGGACCTCAGCGGAAATGATTTCAGGAATCTACCCGCATCAACAAAGAACCTTTCGAAGTTGAAATACGCGAGGCTCTCTAATTGCATCAAACTCGAGGCATTTGTAGAGCTGACTGAGTTGCAGACGCTCAAGCTTTCTGGTTGTACGAACCTCGAATCTCTGCTGGAACTTCCTTATGCGGTTCAAGATGTAGGCAGATTCTGTTTGCTAGCGCTTGAGCTTGATAACTGCAAGAATCTCCAAGCATTATCAGAACAGCTAAGCCATTTCAGCAATTTAATACACTTGGACCTAAGCAGCCACGACTTTGAGGTGCAAGTGTAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MDVDMERLNPLLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEVQV

Domains

Domain Start-End Description Sequence

superfamily: SSF52047
9-163 SSF52047,LRR

NPLLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSS

HMMPanther: PTHR23155:SF345
11-167 PTHR23155:SF345

LLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFE

HMMPanther: PTHR23155
11-167 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFE

Gene3D: G3DSA:3.80.10.10
28-166 G3DSA:3.80.10.10

CISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDF

HMMPfam: PF13855
59-111 LRR_8,Leucine rich repeat

SLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox