PRGDB00046817 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77696330 (DQ220672)
Gene Class TNL
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis lyrata

Comment?

Arabidopsis lyrata ecotype G11 disease resistance protein (At5g18350) gene, partial cds.

DNA Sequence

TCTAAGGATCTGAAAGAGATTCCAGATCTTTCAAATGCTACTAATCTCGAGGAACTAGATCTCTCTAGCTGCTCAGGTTTGTTAGAGCTCACCAACTCTATTGGAAAAGCCACTAAGCTTAAGAGATTGGAACTTCCCGGTTGCTTGCTTTTGAAAAAGCTCCCTTCCTCTATCGGCGATGCCACGAATCTCCAAGTGTTGGATCTTTTCCATTGCGAAAGTTTGGAGGAACTCCCCATTTCTATTGGTAACTTAACTAATCTCGAGGTATTGGAACTCATGCGTTGCTATAAATTGGTGACTCTCCCCACCTCTATCGAGACACTTAATTTGCCGGTGTTGAGCATGAGCGAATGCGAAAATCTAAAGACGTTTCCAACCAACATCAACCTGGATTCCCTCTCTGAAATTGTTCTTGAGGATTGTACACAGTTGAAAATGTTTCCAGAAATTTCAAAAAACATTGAAGAACTCGATCTGAGAAATACTGCAATAGAGAACGTGCCATCTTCGATATGCTCTTGGTCTTGTCTTTACAGGTTGGATATGTCAGGGTGTAGAAACCTCAAGGAGTTCCCAAATGTTCCTAACAGCATCGTAGAGTTGGACTTGAGCAAGACAGAGATAAAGGAAGTTCCTTCATGGATTGAGAATCTCTTTCGTCTGCGTACTCTAACTATGGATGGATGCAAGAAGCTGAGTATTATATCTCCAAACATTTCTAAGCTGGAGAATATTGAATATCTTGAACTGACTACCGGCGGTGTTTCTGGGGATGCGGCTTCTTTTTATGCATTCGTTGAGTTCTCTGACCGTGATGATTGGACTTTAGAATCAGACTTCAAAGTTCACTACATTTTACCGATATGTCTACCCGAGATGGCAATATCATTACGTTTCTTCAGTTATGATTTCGAGACTATTCCAGATTGCATTAGACGTCTCTCCGGACTAAGTGAGCTTGACATTAGTGGATGCAGAAATCTTGTCGCACTCCCACAGCTTCCGGGTTCCCTTTTATCTCTGGATGCAAAGGACTGTGAATCTTTGGAGAGAATAGACGGCTCTTTTCAGAATTCAAAGATTTGTCTAAACTTTGCTAACTGCATCAACCTGAATCAAGAAGCGAGAAAGCTCATTCAGACATCAGCTTGCGAATATGCGCTCTTACCTGGTGCAGAAGTTCCTGCACACTTCACTCACCAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis lyrata].

SKDLKEIPDLSNATNLEELDLSSCSGLLELTNSIGKATKLKRLELPGCLLLKKLPSSIGDATNLQVLDLFHCESLEELPISIGNLTNLEVLELMRCYKLVTLPTSIETLNLPVLSMSECENLKTFPTNINLDSLSEIVLEDCTQLKMFPEISKNIEELDLRNTAIENVPSSICSWSCLYRLDMSGCRNLKEFPNVPNSIVELDLSKTEIKEVPSWIENLFRLRTLTMDGCKKLSIISPNISKLENIEYLELTTGGVSGDAASFYAFVEFSDRDDWTLESDFKVHYILPICLPEMAISLRFFSYDFETIPDCIRRLSGLSELDISGCRNLVALPQLPGSLLSLDAKDCESLERIDGSFQNSKICLNFANCINLNQEARKLIQTSACEYALLPGAEVPAHFTHQ


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-389 SSF52058,LRR

SKDLKEIPDLSNATNLEELDLSSCSGLLELTNSIGKATKLKRLELPGCLLLKKLPSSIGDATNLQVLDLFHCESLEELPISIGNLTNLEVLELMRCYKLVTLPTSIETLNLPVLSMSECENLKTFPTNINLDSLSEIVLEDCTQLKMFPEISKNIEELDLRNTAIENVPSSICSWSCLYRLDMSGCRNLKEFPNVPNSIVELDLSKTEIKEVPSWIENLFRLRTLTMDGCKKLSIISPNISKLENIEYLELTTGGVSGDAASFYAFVEFSDRDDWTLESDFKVHYILPICLPEMAISLRFFSYDFETIPDCIRRLSGLSELDISGCRNLVALPQLPGSLLSLDAKDCESLERIDGSFQNSKICLNFANCINLNQEARKLIQTSACEYAL

HMMPanther: PTHR23155
3-395 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DLKEIPDLSNATNLEELDLSSCSGLLELTNSIGKATKLKRLELPGCLLLKKLPSSIGDATNLQVLDLFHCESLEELPISIGNLTNLEVLELMRCYKLVTLPTSIETLNLPVLSMSECENLKTFPTNINLDSLSEIVLEDCTQLKMFPEISKNIEELDLRNTAIENVPSSICSWSCLYRLDMSGCRNLKEFPNVPNSIVELDLSKTEIKEVPSWIENLFRLRTLTMDGCKKLSIISPNISKLENIEYLELTTGGVSGDAASFYAFVEFSDRDDWTLESDFKVHYILPICLPEMAISLRFFSYDFETIPDCIRRLSGLSELDISGCRNLVALPQLPGSLLSLDAKDCESLERIDGSFQNSKICLNFANCINLNQEARKLIQTSACEYALLPGAEV

HMMPanther: PTHR23155:SF300
3-395 PTHR23155:SF300

DLKEIPDLSNATNLEELDLSSCSGLLELTNSIGKATKLKRLELPGCLLLKKLPSSIGDATNLQVLDLFHCESLEELPISIGNLTNLEVLELMRCYKLVTLPTSIETLNLPVLSMSECENLKTFPTNINLDSLSEIVLEDCTQLKMFPEISKNIEELDLRNTAIENVPSSICSWSCLYRLDMSGCRNLKEFPNVPNSIVELDLSKTEIKEVPSWIENLFRLRTLTMDGCKKLSIISPNISKLENIEYLELTTGGVSGDAASFYAFVEFSDRDDWTLESDFKVHYILPICLPEMAISLRFFSYDFETIPDCIRRLSGLSELDISGCRNLVALPQLPGSLLSLDAKDCESLERIDGSFQNSKICLNFANCINLNQEARKLIQTSACEYALLPGAEV

Gene3D: G3DSA:3.80.10.10
6-131 G3DSA:3.80.10.10

EIPDLSNATNLEELDLSSCSGLLELTNSIGKATKLKRLELPGCLLLKKLPSSIGDATNLQVLDLFHCESLEELPISIGNLTNLEVLELMRCYKLVTLPTSIETLNLPVLSMSECENLKTFPTNINL

HMMPfam: PF00560
IPR001611
15-34 LRR_1
Leucine-rich repeat

NLEELDLSSCSGLLELTNSI

HMMPfam: PF13504
62-79 LRR_7,Leucine rich repeat

TNLQVLDLFHCESLEELP

HMMPfam: PF13504
86-103 LRR_7,Leucine rich repeat

TNLEVLELMRCYKLVTLP

Gene3D: G3DSA:3.80.10.10
132-254 G3DSA:3.80.10.10

DSLSEIVLEDCTQLKMFPEISKNIEELDLRNTAIENVPSSICSWSCLYRLDMSGCRNLKEFPNVPNSIVELDLSKTEIKEVPSWIENLFRLRTLTMDGCKKLSIISPNISKLENIEYLELTTG

HMMPfam: PF13504
177-193 LRR_7,Leucine rich repeat

CLYRLDMSGCRNLKEFP

Gene3D: G3DSA:3.80.10.10
303-357 G3DSA:3.80.10.10

YDFETIPDCIRRLSGLSELDISGCRNLVALPQLPGSLLSLDAKDCESLERIDGSF

HMMPfam: PF13504
317-333 LRR_7,Leucine rich repeat

GLSELDISGCRNLVALP


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox