PRGDB00046820 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77696324 (DQ220669)
Gene Class TNL
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Sq8 disease resistance protein (At5g18350) gene, partial cds.

DNA Sequence

TCTAAGGATCTGAAAGAGATTCCAGATCTTTCAAATGCTACTAATCTCGAGGAACTAGATCTCTCTAGCTGCTCAGGTTTGTTAGAGCTCACCGACTCTATTGGAAAAGCCACTAATCTTAAGAGATTGAAACTTGCCTGTTGCTCTCTTTTGAAAAAGCTACCTTCCTCTATCGGAGATGCCACGAATCTCCAAGTGTTGGATCTTTTCCATTGCGAAAGTTTCGAGGAACTCCCCAAATCTATTGGTAAGTTAACTAATCTCAAGGTATTGGAACTCATGCGTTGTTATAAACTGGTGACTCTCCCCAACTCTATCAAGACACCTAAATTGCCGGTCTTGAGCATGAGCGAATGCGAAGATCTACAGGCGTTTCCAACCTACATCAACCTTGAGGATTGTACACAGTTGAAAATGTTTCCAGAAATTTCAACAAACGTTAAAGAACTCGATCTGAGAAATACTGCAATAGAGAACGTGCCATCTTCGATATGCTCTTGGTCTTGTCTTTACAGATTGGATATGTCAGAGTGTAGAAACCTCAAGGAGTTCCCAAATGTTCCTGTCAGCATCGTAGAGTTGGACTTGAGCAAGACAGAGATAGAGGAAGTTCCTTCATGGATTGAGAATCTCTTACTTCTGCGTACTCTAACTATGGTAGGATGCAAGAGGCTTAATATTATATCTCCAAACATTTCTAAGTTGAAGAATCTTGAAGATCTTGAACTGTTTACCGACGGTGTTTCTGGGGATGCTGCATCTTTTTATGCATTCGTTGAGTTCTCTGACCGGCATGATTGGACTTTAGAATCAGACTTTCAAGTTCACTACATTTTACCGATATGTCTACCCAAGATGGCAATATCATTACGCTTCTGGAGTTATGATTTCGAGACTATTCCAGATTGCATTAACTGTCTCCCCGGGCTTAGTGAGCTTGACGTTAGTGGATGCAGAAATCTCGTCTCACTCCCACAGCTTCCGGGTTCCCTTTTATCTCTAGATGCAAATAACTGTGAATCTTTGGAGAGAATAAACGGCTCTTTTCAAAACCCAGAGATTTGTCTAAACTTTGCTAACTGCATCAACCTGAATCAAGAAGCGAGAAAGCTCATCCAGACATCAGCTTGCGAATATGCGATCTTACCTGGTGCAGAAGTTCCTGCACACTTCACTGACCAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

SKDLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAILPGAEVPAHFTDQ


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-381 SSF52058,LRR

SKDLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAI

HMMPanther: PTHR23155:SF300
3-387 PTHR23155:SF300

DLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAILPGAEV

HMMPanther: PTHR23155
3-387 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAILPGAEV

Gene3D: G3DSA:3.80.10.10
6-133 G3DSA:3.80.10.10

EIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLED

HMMPfam: PF00560
IPR001611
15-34 LRR_1
Leucine-rich repeat

NLEELDLSSCSGLLELTDSI

HMMPfam: PF13504
38-55 LRR_7,Leucine rich repeat

TNLKRLKLACCSLLKKLP

HMMPfam: PF12799
62-96 LRR_4,Leucine Rich repeats (2 copies)

TNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRC

Gene3D: G3DSA:3.80.10.10
134-249 G3DSA:3.80.10.10

CTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVS

Gene3D: G3DSA:3.80.10.10
298-350 G3DSA:3.80.10.10

ETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQ

HMMPfam: PF00560
IPR001611
310-326 LRR_1
Leucine-rich repeat

LSELDVSGCRNLVSLPQ


List of References

Jingdan Shen, Hitoshi Araki, Lingling Chen, Jian-Qun Chen, Dacheng Tian
Unique evolutionary mechanism in R-genes under the presence/absence polymorphism in Arabidopsis thaliana.
Genetics: 2006, 172(2);1243-50
PubMed:16452149 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox