PRGDB00046825 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77696314 (DQ220664)
Gene Class TNL
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Ef-1 disease resistance protein (At5g18350) gene, partial cds.

DNA Sequence

TCTAAGGATCTGAAAGAGATTCCAGATCTTTCAAATGCTACTAATCTCGAGGAACTAGATCTCTCTAGCTGCTCAGGTTTGTTAGAGCTCACCGACTCTATTGGAAAAGCCACTAATCTTAAGAGATTGAAACTTGCCTGTTGCTCTCTTTTGAAAAAGCTACCTTCCTCTATCGGAGATGCCACGAATCTCCAAGTGTTGGATCTTTTCCATTGCGAAAGTTTCGAGGAACTCCCCAAATCTATTGGTAAGTTAACTAATCTCAAGGTATTGGAACTCATGCGTTGTTATAAACTGGTGACTCTCCCCAACTCTATCAAGACACCTAAATTGCCGGTCTTGAGCATGAGCGAATGCGAAGATCTACAGGCGTTTCCAACCTACATCAACCTTGAGGATTGTACACAGTTGAAAATGTTTCCAGAAATTTCAACAAACGTTAAAGAACTCGATCTGAGAAATACTGCAATAGAGAACGTGCCATCTTCGATATGCTCTTGGTCTTGTCTTTACAGATTGGATATGTCAGAGTGTAGAAACCTCAAGGAGTTCCCAAATGTTCCTGTCAGCATCGTAGAGTTGGACTTGAGCAAGACAGAGATAGAGGAAGTTCCTTCATGGATTGAGAATCTCTTACTTCTGCGTACTCTAACTATGGTAGGATGCAAGAGGCTTAATATTATATCTCCAAACATTTCTAAGTTGAAGAATCTTGAAGATCTTGAACTGTTTACCGACGGTGTTTCTGGGGATGCTGCATCTTTTTATGCATTCGTTGAGTTCTCTGACCGGCATGATTGGACTTTAGAATCAGACTTTCAAGTTCACTACATTTTACCGATATGTCTACCCAAGATGGCAATATCATTACGCTTCTGGAGTTATGATTTCGAGACTATTCCAGATTGCATTAACTGTCTCCCCGGGCTTAGTGAGCTTGACGTTAGTGGATGCAGAAATCTCGTCTCACTCCCACAGCTTCCGGGTTCCCTTTTATCTCTAGATGCAAATAACTGTGAATCTTTGGAGAGAATAAACGGCTCTTTTCAAAACCCAGAGATTTGTCTAAACTTTGCTAACTGCATCAACCTGAATCAAGAAGCGAGAAAGCTCATCCAGACATCAGCTTGCGAATATGCGATCTTACCTGGTGCAGAAGTTCCTGCACACTTCACTGACCAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

SKDLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAILPGAEVPAHFTDQ


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-381 SSF52058,LRR

SKDLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAI

HMMPanther: PTHR23155
3-387 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAILPGAEV

HMMPanther: PTHR23155:SF300
3-387 PTHR23155:SF300

DLKEIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVSGDAASFYAFVEFSDRHDWTLESDFQVHYILPICLPKMAISLRFWSYDFETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQNPEICLNFANCINLNQEARKLIQTSACEYAILPGAEV

Gene3D: G3DSA:3.80.10.10
6-133 G3DSA:3.80.10.10

EIPDLSNATNLEELDLSSCSGLLELTDSIGKATNLKRLKLACCSLLKKLPSSIGDATNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRCYKLVTLPNSIKTPKLPVLSMSECEDLQAFPTYINLED

HMMPfam: PF00560
IPR001611
15-34 LRR_1
Leucine-rich repeat

NLEELDLSSCSGLLELTDSI

HMMPfam: PF13504
38-55 LRR_7,Leucine rich repeat

TNLKRLKLACCSLLKKLP

HMMPfam: PF12799
62-96 LRR_4,Leucine Rich repeats (2 copies)

TNLQVLDLFHCESFEELPKSIGKLTNLKVLELMRC

Gene3D: G3DSA:3.80.10.10
134-249 G3DSA:3.80.10.10

CTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSECRNLKEFPNVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLELFTDGVS

Gene3D: G3DSA:3.80.10.10
298-350 G3DSA:3.80.10.10

ETIPDCINCLPGLSELDVSGCRNLVSLPQLPGSLLSLDANNCESLERINGSFQ

HMMPfam: PF00560
IPR001611
310-326 LRR_1
Leucine-rich repeat

LSELDVSGCRNLVSLPQ


List of References

Jingdan Shen, Hitoshi Araki, Lingling Chen, Jian-Qun Chen, Dacheng Tian
Unique evolutionary mechanism in R-genes under the presence/absence polymorphism in Arabidopsis thaliana.
Genetics: 2006, 172(2);1243-50
PubMed:16452149 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox