PRGDB00046869 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77696226 (DQ220494)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Rf-4 disease resistance protein (At4g10780) gene, partial cds.

DNA Sequence

AGTTGGTCGCCTTGAGATATCTCGATTTGTCACATACAAACATAGAGGGGCTGCCTGCTTGTCTCCAAGATTTGAAAACATTAATACATTTGAATTTGGAGTGTATGAGGAGACTTGGGAGTATAGCTGGTATATCGAAGTTGTCGAGTTTAAGAACACTAGGACTAAGAAATTCTAATATTATGCTAGATGTTATGTCAGTGAAGGAGCTGCATTTATTGGAACATCTAGAGATTTTAACCATAGATATTGTGTCAACTATGGTTTTGGAGCAAATGATTGACGCTGGCACTTTGATGAATTGTATGCAAGAGGTATCTATTCGTTGTCTCATTTATGACCAAGAACAAGACACAAAGTTACGTCTGCCAACTATGGATAGCCTTCGTAGTCTGACCATGTGGAACTGTGAAATTTCAGAGATAGAGATAGAGAGGTTAACATGGAACACAAATCCAACAAGTCCATGTTTCTTCAACCTCTCCCAAGTCATTATTCATGTTTGTTCTAGTCTCAAGGATTTGACTTGGCTATTGTTTGCTCCGAACATTACTTATCTCATGATTGAGCAGTTGGAGCAGCTACAAGAATTAATTAGTCACGCAAAAGCCACCGGTGTTACTGAGGAGCAGCAACAACTGCATAAGATTATTCCTTTCCAGAAATTACAAATTCTACACTTGTCTAGTTTACCTGAGCTAAAGAGCATCTATTGGATTTCTCTGTCTTTTCCATGCCTAAGTGGAATCTACGTGGAAAGATGTCCAAAGCTGAGAAAACTTCCATTGGATTCTAAAACTGGTACCGTTGGAAAGAAGT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

LVALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSIAGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQMIDAGTLMNCMQEVSIRCLIYDQEQDTKLRLPTMDSLRSLTMWNCEISEIEIERLTWNTNPTSPCFFNLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEQQQLHKIIPFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLPLDSKTGTVGKK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-265 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LVALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSIAGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQMIDAGTLMNCMQEVSIRCLIYDQEQDTKLRLPTMDSLRSLTMWNCEISEIEIERLTWNTNPTSPCFFNLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEQQQLHKIIPFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLPLDSK

superfamily: SSF52058
1-266 SSF52058,LRR

LVALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSIAGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQMIDAGTLMNCMQEVSIRCLIYDQEQDTKLRLPTMDSLRSLTMWNCEISEIEIERLTWNTNPTSPCFFNLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEQQQLHKIIPFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLPLDSKT

HMMPanther: PTHR23155:SF108
1-265 PTHR23155:SF108,SUBFAMILY NOT NAMED

LVALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSIAGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQMIDAGTLMNCMQEVSIRCLIYDQEQDTKLRLPTMDSLRSLTMWNCEISEIEIERLTWNTNPTSPCFFNLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEQQQLHKIIPFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLPLDSK

Gene3D: G3DSA:3.80.10.10
1-264 G3DSA:3.80.10.10

LVALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSIAGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQMIDAGTLMNCMQEVSIRCLIYDQEQDTKLRLPTMDSLRSLTMWNCEISEIEIERLTWNTNPTSPCFFNLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEQQQLHKIIPFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLPLDS


List of References

Jingdan Shen, Hitoshi Araki, Lingling Chen, Jian-Qun Chen, Dacheng Tian
Unique evolutionary mechanism in R-genes under the presence/absence polymorphism in Arabidopsis thaliana.
Genetics: 2006, 172(2);1243-50
PubMed:16452149 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox