PRGDB00046895 (RPS5)

From PRG Wiki
Jump to: navigation, search
RPS5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77632441 (DQ220642)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Arabidopsis lyrata

Comment?

Arabidopsis lyrata ecotype V15 disease resistance protein (RPS5) gene, partial cds.

DNA Sequence

ATGGGAGGTTGTTTCTCTGTTTCATTGCCATGTGATCAAGTAGTGAGTCAGTTCTCTCAGTTGTTATGTGTCAGGGGGAGTTATATTCACAATCTCTCCGAGAATCTGGCTTCTCTAGAGAAGGCCATGAGAATGCTCAAGGCTCAGCAATATGATGTGATAAGAAGGCTGGAAAGAGAAGAGTTTACAGGGCGTCAACAAAGGCTTTCCCAAGTTCAGGTATGGCTTACTAGTGTCCTAATCATTCAAAACCAGTTTGATGATCTGCTTCCTAGTAAAGAGGTTGAGCTTCAAAGGTTATGTCTCTGTGGTTTCTGCTCCAAAGATTTGAAATTGAGCTATCGATATGGGAAAAGGGTTAACATGATGTTGAGGGAAGTTGAGAGTCTCCGTTCTCAAGGATTTTTTGATGTGGTGGCTGAGGCAACTCCGTTTGCTGAGGTGGATGAGATCCCTTTTCAACCCACAATTGTTGGTCAAGAAATAATGCTTGAAAAAGCATGGAACCGTCTCATGGAAGATGGATCCGGGATTTTGGGTCTGTACGGTATGGGGGGAGTAGGCAAAACCACACTACTCACCAAGATCAACAATAACTTTTCTAAAATAGGTGACAGATTTGATGTTGTGATCTGGGTTGTTGTGTCTAGAAGTTCAACAGTCCGTAAGATTGAAAGAGACATAGCAGAAAAGGTTGGCCTTGGGGGAATGGAGTGGGGCGAGAGAAACGATAACCAGACACCCGTTGACATCCACAATGTCCTTAGGAGACGAAAATTTGTTTTGTTGTTGGATGACATATGGGAGAAAGTTAATTTAAAAGCGGTTGGAGTCCCGTATCCAAGCAAAGATAACGGATGCAAGGTAGCATTCACTACTCGTTCTCGAGATGTGTGTGGGCGCATGGGGGTTGATGATCCGATGGAAGTTAGCTGTCTACAACCCGAAGAATCATGGGATTTGTTCCAAATGATAGTTGGGAAAAATACACTGGGAAGTCACCCGGACATTCCCGGACTTGCTAGAAAAGTCGCTAGGAAATGCCGTGGCCTACCATTAGCACTCAATGTTATCGGTGAAGCTATGGCATGCAAAAGAACAGTACATGAATGGTCTCATGCCATTGACGTTTTGACATCATCTGCCACAGATTTTTCAGGTATGGAAGATGAAATTCTCCATGTTTTGAAGTATAGCTATGATAATTTAAATGGGGAGCTGATGAAATCCTGCTTCCTGTATTGCTCTCTGTTTCCTGAAGATTACCTTATTGATAAAGAGGGGTTGGTAGACTACGGGATATGTGAGGGATTTATAAATGAAAAAGAAGGCAGAGAGAGGACACTAAACCAAGGTTATGAGATAATTGGTACCCTTGTCCGTGCATGTTTGTTGATGGAGGAAGAAAGGAACAAATCAAATGTAAAAATGCATGATGTGGTTCGTGAGATGGCTCTATGGATATCATCCGATCTTGGGAAGCAAAAGGAGAAATGTATTGTGCGAGCTGGTGTTGGGTTATGTGAAGTACCACAAGTCAAGGATTGGAACACTGTAAGAAAGATGTCTTTGATGAATAATGAGATTGAAGAGATATTTGACAGTCACGAGTGTGCTGCACTTACAACTCTATTTCTCCAAAAGAACGACATGGTAAAGATCTCGGCTGAATTCTTTCGATGTATGCCTCATCTGGTGGTTTTAGATCTATCAGAGAATCACAGTCTCAATGAATTACCAGAAGAAATATCAGAGTTGGTCTCTTTGAGATATTTCAACTTGTCATATACTTGTATACATCAACTACCCGTTGGTTTATGGACATTGAAAAAGCTAATACATCTGAATCTCGAACACATGAGCAGTCTTGGGAGTATATTAGGGATATCAAATTTGTGGAATTTGAGGACATTGGGACTACGAGATTCCAAACTGTTGCTAGATATGAGTTTAGTGAAGGAGCTGCAGCTCTTAGAACATCTAGAAGTTGTGACCCTAGATATATCATCAAGTTTGGTTGCAGAGCCATTGTTATGCTCTCACAGGTTGGTGGAATGTATAAAAGAGGTAGATATTAAGTATCTTAAGGAAGAAGCAGTAAGAGTATTGACTCTGCCAACCATGGGTAATCTCCGTAGGCTCGGGATAAAAATGTGTGGAATGAGGGAGATAAAGATAGAGTCGACAACTTCATCATCATCGCGGAACATAAGTCCCACAACTCCATTCTTCTCCAACCTCTCCAGAGTCTTTATAGCTAAATGCCATGGTCTTAAGGATTTGACGTGGCTGCTGTTTGCTCCGAATCTTACTTTTCTTGAAGTTGGGTTCTCAAAGGAAGTAGAGGATATAATTAGCGCAGAGAAAGCTGACGAGCATTCTTCAGCTACGATTGTTCCTTTTAGGAAACTAGAAACGCTACACCTGCTTGAATTACGCGGGCTCAAGAGAATCTATGCGAAGACTCTGCCTTTTCCGTGTCTGAAAGTTATCCACGTACAAAAATGTGAAAAGCTGAGAAAGCTTCCATTGGATTCGAAAAGTGGGATCGCGGGTGAAGAACTTATCATATATTATGGAGAGAGAGAATGGATCGAAAGGGTTGAATGGGAGGACCAAGCCACTCAACTCCGTTTCTTACCTTCATCCAGTTGGCTGTGGAGAGAAACACAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis lyrata].

MGGCFSVSLPCDQVVSQFSQLLCVRGSYIHNLSENLASLEKAMRMLKAQQYDVIRRLEREEFTGRQQRLSQVQVWLTSVLIIQNQFDDLLPSKEVELQRLCLCGFCSKDLKLSYRYGKRVNMMLREVESLRSQGFFDVVAEATPFAEVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMIVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWSHAIDVLTSSATDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYGICEGFINEKEGRERTLNQGYEIIGTLVRACLLMEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLCEVPQVKDWNTVRKMSLMNNEIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEEAVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNISPTTPFFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISAEKADEHSSATIVPFRKLETLHLLELRGLKRIYAKTLPFPCLKVIHVQKCEKLRKLPLDSKSGIAGEELIIYYGEREWIERVEWEDQATQLRFLPSSSWLWRETQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
7-882 PTHR23155:SF108,SUBFAMILY NOT NAMED

VSLPCDQVVSQFSQLLCVRGSYIHNLSENLASLEKAMRMLKAQQYDVIRRLEREEFTGRQQRLSQVQVWLTSVLIIQNQFDDLLPSKEVELQRLCLCGFCSKDLKLSYRYGKRVNMMLREVESLRSQGFFDVVAEATPFAEVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMIVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWSHAIDVLTSSATDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYGICEGFINEKEGRERTLNQGYEIIGTLVRACLLMEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLCEVPQVKDWNTVRKMSLMNNEIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEEAVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNISPTTPFFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISAEKADEHSSATIVPFRKLETLHLLELRGLKRIYAKTLPFPCLKVIHVQKCEKLRKLPLDSKSGIAGEELIIYYGEREWIERVEWEDQATQLRFLPS

HMMPanther: PTHR23155
7-882 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VSLPCDQVVSQFSQLLCVRGSYIHNLSENLASLEKAMRMLKAQQYDVIRRLEREEFTGRQQRLSQVQVWLTSVLIIQNQFDDLLPSKEVELQRLCLCGFCSKDLKLSYRYGKRVNMMLREVESLRSQGFFDVVAEATPFAEVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMIVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWSHAIDVLTSSATDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYGICEGFINEKEGRERTLNQGYEIIGTLVRACLLMEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLCEVPQVKDWNTVRKMSLMNNEIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEEAVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNISPTTPFFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISAEKADEHSSATIVPFRKLETLHLLELRGLKRIYAKTLPFPCLKVIHVQKCEKLRKLPLDSKSGIAGEELIIYYGEREWIERVEWEDQATQLRFLPS

superfamily: SSF52540
137-384 SSF52540

DVVAEATPFAEVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMIVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWSHAIDVLTSSATD

HMMPfam: PF00931
IPR002182
161-442 NB-ARC,NBS
NB-ARC

EIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMIVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWSHAIDVLTSSATDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYGICEGFINEK

Gene3D: G3DSA:3.40.50.300
168-268 G3DSA:3.40.50.300

WNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIW

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

ILGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
254-268 DISEASERSIST
Disease resistance protein

VLRRRKFVLLLDDIW

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGEAM

superfamily: SSF52058
460-881 SSF52058,LRR

VRACLLMEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLCEVPQVKDWNTVRKMSLMNNEIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEEAVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNISPTTPFFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISAEKADEHSSATIVPFRKLETLHLLELRGLKRIYAKTLPFPCLKVIHVQKCEKLRKLPLDSKSGIAGEELIIYYGEREWIERVEWEDQATQLRFLP

Gene3D: G3DSA:3.80.10.10
504-837 G3DSA:3.80.10.10

GVGLCEVPQVKDWNTVRKMSLMNNEIEEIFDSHECAALTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEEAVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNISPTTPFFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISAEKADEHSSATIVPFRKLETLHLLELRGLKRIYAKTLPFPCLKVIHVQKCE

HMMPfam: PF13855
541-597 LRR_8,Leucine rich repeat

LTTLFLQKNDMVKISAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYT

FPrintScan: PR00364
IPR000767
560-576 DISEASERSIST
Disease resistance protein

RCMPHLVVLDLSENHSL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox