PRGDB00046896 (RPS5)

From PRG Wiki
Jump to: navigation, search
RPS5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77632439 (DQ220641)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Arabidopsis lyrata

Comment?

Arabidopsis lyrata ecotype S13 disease resistance protein (RPS5) gene, partial cds.

DNA Sequence

ATGGGAGGTTGTTTCTCTGTTTCATTGCCATGTGATCAAGTAGTGAGTCAGTTCTCTCAGTTGTTATGTGTCAGGGGGAGTTATATTCACAATCTCTCCGAGAATCTGGCTTCTCTAGAGAAGGCCATGAGAATGCTCAAGGCTCAGCAATATGATGTGATAAGAAGGCTGGAAAGAGAAGAGTTTACAGGGCGTCAACAAAGGCTTTCCCAAGTTCAGGTATGGCTTACTAGTGTCCTAATCATTCAAAACCAGTTTGATGATCTGCTTCCTAGTAAAGAGGTTGAGCTTCAAAGGTTATGTCTCTGTGGTTTCTGCTCCAAAGATTTGAAATTGAGCTATCGATATGGGAAAAGGGTTAACATGATGTTGAGGGAAGTTGAGAGTCTCCGTTCTCAAGGATTTTTTGATGTGGTGGCTGAGGCAACTCCGTTTGCTGAGGTGGATGAGATCCCTTTTCAACCCACAATTGTTGGTCAAGAAATAATGCTTGAAAAAGCATGGAACCGTCTCATGGAAGATGGATCCGGGATTTTGGGTCTGTACGGTATGGGGGGAGTAGGCAAAACCACACTACTCACCAAGATCAACAATAACTTTTCTAAAATAGGTGACAGATTTGATGTTGACGTTGTGATCTGGGTTGTTGTGTCTAGAAGTTCAACAGTCCGTAAGATTGAAAGAGACATAGCAGAAAAGGTTGGCCTTGGGGGAATGGAGTGGGGCGAGAGAAACGATAACCAGACACCCGTTGACATCCACAATGTCCTTAGGAGACGAAAATTTGTTTTATTGTTGGATGACATATGGGAGAAAGTTAATTTAAAAGCGGTTGGAGTCCCGTATCCTAGCAAAGATAACGGATGCAAGGTAGCATTTACTACTCGTTCTCGAGATGTGTGTGGGCGCATGGGGGTTGATGATCCGATGGAAGTTAGCTGTCTACAACCCGAAGAATCATGGGATTTGTTCCAAATGATAGTTGGGAAAAATACACTAGGAAGTCACCCGGACATTCCCGGACTTGCTAGAAAAGTCGCTAGGAAATGCCGTGGCCTACCATTAGCACTCAATGTTATCGGTGAAGCTATGGCATGCAAAAGAACAGTACATGAATGGTCTCATGCCATTGACGTTTTGACATCATCTGCCACAGATTTTTCAGGTATGGAAGATGAAATTCTCCATGTTTTGAAGTATAGCTATGATAATTTAAATGGGGAGCTGATGAAATCCTGCTTCCTGTATTGCTCTCTGTTTCCTGAAGATTACCTTATTGATAAAGAGGGGTTGGTAGACTACGGGATATGTGAGGGATTTATAAATGAAAAAGAAGGCAGAGAGAGGACACTAAACCAAGGTTATGAGATAATTGGTACCCTTGTCCGTGCATGTTTGTTGATGGAGGAAGAAAGGAACAAATCAAATGTAAAAATGCATGATGTGGTTCGTGAGATGGCTCTATGGATATCATCCGATCTTGGGAAGCAAAAGGAGAAATGTATTGTGCGAGCCGGTGTTGGGTTATGTGAAGTACCAAAAGTCAAGGATTGGAACACTGTGAGAAAGTTGTCTTTGATGAATAATGAGATTGAAGAGATATTTGACAGTCACGAGTGTGCTGCACTTACAACTCTATTTCTCCAAAAGAACGATATGGTAAAGATCTTGGCTGAATTCTTTCGATGTATGCCTCATCTGGTGGTTTTAGATCTATCAGAGAACCACAGTCTTAATGAATTACCAGAAGAAATATCAGAGTTGGTCTCTTTGAGATATTTCAACTTGTCATATACTTGTATACATCAACTACCCGTTGGTTTATGGACATTGAAAAAGCTAATACATCTGAATCTCGAACACATGAGCAGTCTTGGGAGTATATTAGGGATATCAAATTTGTGGAATTTGAGGACATTGGGACTACGAGATTCCAAACTGTTGCTAGATATGAGTTTAGTGAAGGAGCTGCAGCTCTTAGAACATCTAGAAGTTGTGACCCTAGATATATCATCAAGTTTGGTTGCAGAGCCATTGTTATGCTCTCACAGGTTGGTGGAATGTATAAAAGAGGTAGATATTAAGTACCTTAAGGAAGAATCAGTGAGAGTATTGACTCTGCCAACCATGGGTAATCTCCGTAGGCTCGGGATAAAAATGTGTGGAATGAGGGAGATAAAGATAGAGTCGACAACTTCATCATCATCGCGGAACATAAGTCCCACAACTCCATTCTTCTCCAACCTCTCCAGAGTCTTTATAGCTAAATGCCATGGTCTTAAGGATTTGACGTGGCTGTTGTTTGCTCCGAATCTCACTTTTCTTGAAGTTGGGTTCTCAAAGGAAGTAGAGGATATAATTAGCGCAGAGAAAGCTGACGAGCATTCTTCAGCTACGATTGTTCCTTTTAGGAAACTAGAAACGCTACACCTGCTTGAATTACGCGGGCTTAAGAGAATCTATGCGAAGACTCTGCCTTTTCCGTGTCTGAAAGTTATCCACGTACAAAAATGTGAAAAGCTGAGAAAGCTTCCATTGGATTCTAAAAGTGGGATCGCGGGTGAAGAACTTATCATATATTATGGAGAGAGAGAATGGATCGAAAGGGTTGAATGGGAGGACCAAGCCACTCAACTCCGTTTCTTACCTTCATCCAGTTGGCTGTGGAGAGAAACACAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis lyrata].

MGGCFSVSLPCDQVVSQFSQLLCVRGSYIHNLSENLASLEKAMRMLKAQQYDVIRRLEREEFTGRQQRLSQVQVWLTSVLIIQNQFDDLLPSKEVELQRLCLCGFCSKDLKLSYRYGKRVNMMLREVESLRSQGFFDVVAEATPFAEVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMIVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWSHAIDVLTSSATDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYGICEGFINEKEGRERTLNQGYEIIGTLVRACLLMEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLCEVPKVKDWNTVRKLSLMNNEIEEIFDSHECAALTTLFLQKNDMVKILAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNISPTTPFFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISAEKADEHSSATIVPFRKLETLHLLELRGLKRIYAKTLPFPCLKVIHVQKCEKLRKLPLDSKSGIAGEELIIYYGEREWIERVEWEDQATQLRFLPSSSWLWRETQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
7-884 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VSLPCDQVVSQFSQLLCVRGSYIHNLSENLASLEKAMRMLKAQQYDVIRRLEREEFTGRQQRLSQVQVWLTSVLIIQNQFDDLLPSKEVELQRLCLCGFCSKDLKLSYRYGKRVNMMLREVESLRSQGFFDVVAEATPFAEVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMIVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWSHAIDVLTSSATDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYGICEGFINEKEGRERTLNQGYEIIGTLVRACLLMEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLCEVPKVKDWNTVRKLSLMNNEIEEIFDSHECAALTTLFLQKNDMVKILAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNISPTTPFFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISAEKADEHSSATIVPFRKLETLHLLELRGLKRIYAKTLPFPCLKVIHVQKCEKLRKLPLDSKSGIAGEELIIYYGEREWIERVEWEDQATQLRFLPS

HMMPanther: PTHR23155:SF108
7-884 PTHR23155:SF108,SUBFAMILY NOT NAMED

VSLPCDQVVSQFSQLLCVRGSYIHNLSENLASLEKAMRMLKAQQYDVIRRLEREEFTGRQQRLSQVQVWLTSVLIIQNQFDDLLPSKEVELQRLCLCGFCSKDLKLSYRYGKRVNMMLREVESLRSQGFFDVVAEATPFAEVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMIVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWSHAIDVLTSSATDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYGICEGFINEKEGRERTLNQGYEIIGTLVRACLLMEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLCEVPKVKDWNTVRKLSLMNNEIEEIFDSHECAALTTLFLQKNDMVKILAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNISPTTPFFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISAEKADEHSSATIVPFRKLETLHLLELRGLKRIYAKTLPFPCLKVIHVQKCEKLRKLPLDSKSGIAGEELIIYYGEREWIERVEWEDQATQLRFLPS

superfamily: SSF52540
137-386 SSF52540

DVVAEATPFAEVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMIVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWSHAIDVLTSSATD

HMMPfam: PF00931
IPR002182
161-444 NB-ARC,NBS
NB-ARC

EIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMIVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWSHAIDVLTSSATDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYGICEGFINEK

Gene3D: G3DSA:3.40.50.300
168-270 G3DSA:3.40.50.300

WNRLMEDGSGILGLYGMGGVGKTTLLTKINNNFSKIGDRFDVDVVIWVVVSRSSTVRKIERDIAEKVGLGGMEWGERNDNQTPVDIHNVLRRRKFVLLLDDIW

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

ILGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
256-270 DISEASERSIST
Disease resistance protein

VLRRRKFVLLLDDIW

FPrintScan: PR00364
IPR000767
350-364 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGEAM

superfamily: SSF52058
462-883 SSF52058,LRR

VRACLLMEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLCEVPKVKDWNTVRKLSLMNNEIEEIFDSHECAALTTLFLQKNDMVKILAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTMGNLRRLGIKMCGMREIKIESTTSSSSRNISPTTPFFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISAEKADEHSSATIVPFRKLETLHLLELRGLKRIYAKTLPFPCLKVIHVQKCEKLRKLPLDSKSGIAGEELIIYYGEREWIERVEWEDQATQLRFLP

Gene3D: G3DSA:3.80.10.10
541-710 G3DSA:3.80.10.10

AALTTLFLQKNDMVKILAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSKLLLDMSLVKELQLLEHLEVVTLDISSSLVAEPLLCSHRLVECIKEVDIKYLKEESVRVLTLPTM

HMMPfam: PF13855
543-599 LRR_8,Leucine rich repeat

LTTLFLQKNDMVKILAEFFRCMPHLVVLDLSENHSLNELPEEISELVSLRYFNLSYT

FPrintScan: PR00364
IPR000767
562-578 DISEASERSIST
Disease resistance protein

RCMPHLVVLDLSENHSL

Gene3D: G3DSA:3.80.10.10
747-766 G3DSA:3.80.10.10

SNLSRVFIAKCHGLKDLTWL

Gene3D: G3DSA:3.80.10.10
835-847 G3DSA:3.80.10.10

VQKCEKLRKLPLD


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox