PRGDB00046907 (RPS5)

From PRG Wiki
Jump to: navigation, search
RPS5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77632417 (DQ220630)
Gene Class NL
Domain Type LRR, LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Bla-2 disease resistance protein (RPS5) gene, complete cds.

DNA Sequence

ATGGGAGGTTGTTTCTCTGTTTCATTGCCATGTGATCAAGTAGTGAGTCAGTTCTCTCAGTTGTTATGTGTCAGGGGAAGTTATATTCACAATCTCTCCAAGAATCTGGCTTCTCTGCAGAAGGCCATGCGAATGCTCAAGGCTCGGCAATATGATGTGATAAGAAGGTTGGAAACAGAAGAGTTTACAGGGCGTCAACAAAGGCTTTCCCAAGTTCAGGTATGGCTTACTAGTGTCCTAATCATTCAAAACCAGTTTGATGATCTGCTTCGTAGTAATGAAGTTGAGCTTCAAAGGTTGTGTCTTTGTGGTTTCTGCTCCAAAGATTTGAAATTGAGCTATCGTTATGGGAAAAGAGTTATCATGATGTTGAAGGAAGTTGAGAGTCTCAGTTCTCAAGGATTCTTTGATGTGGTTTCTGAGGCAACTCCGTTTGCTGATGTGGATGAGATCCCTTTTCAACCCACAATTGTTGGTCAGGAGATAATGCTTGAAAAGGCATGGAACCGTCTCATGGAAGATGGATCCGGGATTTTGGGTCTGTACGGTATGGGGGGAGTAGGCAAAACGACACTACTCACGAAGATCAACAATAAGTTTTCTAAAATAGATGACAGATTTGATGTTGTGATATGGGTTGTTGTGTCTAGAAGTTCAACAGTCCGTAAGATACAAAGAGACATAGCAGAAAAGGTAGGCCTTGGGGGAATGGAGTGGAGCGAGAAAAACGATAACCAGATAGCCGTTGACATCCACAATGTCCTTAGGAGACGAAAGTTTGTTTTATTGTTGGATGACATATGGGAGAAAGTGAATTTAAAAGCGGTTGGAGTCCCGTATCCAAGCAAAGATAACGGATGCAAGGTAGCATTCACTACTCGTTCTCGAGATGTGTGTGGGCGCATGGGGGTTGATGATCCGATGGAAGTTAGCTGTCTACAACCCGAAGAATCTTGGGATTTGTTTCAAATGAAGGTTGGGAAAAATACACTGGGAAGTCACCCAGACATTCCCGGACTTGCTAGAAAAGTCGCTAGGAAATGTCGTGGCCTACCATTAGCACTCAATGTTATCGGTGAAGCTATGGCATGCAAAAGAACAGTACATGAATGGTGTCATGCCATTGACGTTTTAACATCATCTGCCATAGATTTTTCAGGTATGGAAGATGAAATTCTCCATGTTTTGAAGTATAGCTATGATAATTTAAATGGGGAGCTGATGAAATCCTGCTTCCTCTATTGCTCTCTGTTTCCTGAAGACTATCTTATTGATAAAGAGGGGTTGGTAGACTACTGGATAAGTGAGGGATTCATAAATGAAAAAGAAGGCAGAGAGAGGAATATTAACCAAGGTTATGAGATAATTGGTACCCTTGTCCGTGCATGTTTGTTGTTGGAGGAAGAAAGGAACAAATCAAACGTGAAAATGCATGATGTGGTTCGTGAGATGGCTCTATGGATATCATCCGATCTTGGGAAGCAAAAGGAGAAATGTATTGTGCGAGCTGGTGTTGGGTTACGTGAAGTACCAAAAGTCAAGGATTGGAACACTGTGAGAAAGATTTCTTTGATGAATAATGAGATTGAAGAGATATTTGACAGTCACGAGTGTGCTGCACTTACAACTCTATTTCTCCAAAAGAACGACGTGGTAAAGATCTCGGCTGAATTCTTTCGATGTATGCCTCATCTGGTGGTTTTAGATCTATCAGAGAATCAGAGTCTTAATGAATTACCAGAAGAAATATCAGAGCTGGCCTCTTTGAGATATTTCAACTTGTCATATACATGTATACATCAACTACCCGTTGGTTTATGGACATTGAAAAAGCTAATACATCTGAATCTCGAACACATGAGCAGTCTTGGGAGTATATTAGGGATATCAAATTTGTGGAATTTGAGGACATTGGGACTACGAGATTCCAGACTGTTGCTAGATATGAGTTTAGTGAAGGAGCTGCAGCTCTTAGAACATCTAGAAGTTATAACCCTAGATATATCATCAAGTTTGGTTGCAGAGCCATTGTTATGCTCTCAAAGGTTGGTGGAATGTATAAAAGAGGTAGATTTTAAGTACCTTAAGGAAGAATCAGTGAGAGTATTGACTTTGCCAACCATGGGTAATCTCCGCAAGCTCGGGATAAAAAGATGTGGAATGAGGGAGATAAAGATAGAGAGGACAACTTCATCATCGTCTCGGAACAAAAGTCCCACAACTCCATGCTTCTCAAACCTCTCCAGAGTCTTTATAGCTAAATGCCATGGTCTTAAGGATTTGACGTGGCTTTTGTTTGCTCCTAATCTTACTTTTCTTGAAGTTGGGTTCTCAAAGGAAGTAGAGGATATACTTAGTGAAGAGAAAGCTGAGGAGCATTCAGCTACGATTGTTCCTTTTAGGAAATTGGAGACACTACACCTGTTTGAATTACGCGGGCTCAAGAGAATCTATGCAAAGGCTCTGCATTTTCCGTGTCTGAAAGTTATCCACGTAGAAAAATGTGAAAAGCTGAGAAAGCTTCCATTGGATTCTAAAAGTGGGATCGCGGGTGAAGAACTTGTCATATATTATGGAGAGAGAGAATGGATAGAAAGGGTTGAATGGGAGGACCAAGCAACTCAACTCCGTTTCTTACCTTCATCCAGGTGGCGGTGGAGAGAAACATAA


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MGGCFSVSLPCDQVVSQFSQLLCVRGSYIHNLSKNLASLQKAMRMLKARQYDVIRRLETEEFTGRQQRLSQVQVWLTSVLIIQNQFDDLLRSNEVELQRLCLCGFCSKDLKLSYRYGKRVIMMLKEVESLSSQGFFDVVSEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEKEGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDILSEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLPSSRWRWRET

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
7-881 PTHR23155:SF108,SUBFAMILY NOT NAMED

VSLPCDQVVSQFSQLLCVRGSYIHNLSKNLASLQKAMRMLKARQYDVIRRLETEEFTGRQQRLSQVQVWLTSVLIIQNQFDDLLRSNEVELQRLCLCGFCSKDLKLSYRYGKRVIMMLKEVESLSSQGFFDVVSEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEKEGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDILSEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLPS

HMMPanther: PTHR23155
7-881 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VSLPCDQVVSQFSQLLCVRGSYIHNLSKNLASLQKAMRMLKARQYDVIRRLETEEFTGRQQRLSQVQVWLTSVLIIQNQFDDLLRSNEVELQRLCLCGFCSKDLKLSYRYGKRVIMMLKEVESLSSQGFFDVVSEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEKEGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDILSEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLPS

superfamily: SSF52540
140-384 SSF52540

SEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAID

HMMPfam: PF00931
IPR002182
161-442 NB-ARC,NBS
NB-ARC

EIMLEKAWNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEK

Gene3D: G3DSA:3.40.50.300
168-268 G3DSA:3.40.50.300

WNRLMEDGSGILGLYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWSEKNDNQIAVDIHNVLRRRKFVLLLDDIW

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

ILGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
254-268 DISEASERSIST
Disease resistance protein

VLRRRKFVLLLDDIW

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGEAM

superfamily: SSF52058
460-880 SSF52058,LRR

VRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDILSEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLP

Gene3D: G3DSA:3.80.10.10
504-838 G3DSA:3.80.10.10

GVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEHLEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCGMREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDILSEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKL

HMMPfam: PF13855
541-597 LRR_8,Leucine rich repeat

LTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYT

FPrintScan: PR00364
IPR000767
560-576 DISEASERSIST
Disease resistance protein

RCMPHLVVLDLSENQSL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox