PRGDB00046910 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 74231151 (DQ002468)
Gene Class TNL
Domain Type LRR, NBS, LRR, LRR, TIR, Others
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris isolate TL5601 disease resistance protein gene, partial cds.

DNA Sequence

ATGTCAGGAAGTTCTTCATCATTCCCCGTGTCTACTTCTCTAACAAAGCATGATGTGTTTCTCAGCTTCAGAGGGGAAGACACACGTGACAACTTCATTAGCCACCTTTATGCAGCGCTTCAAAGGAAGAACATCGAAGCATATATTGATTACAGACTACTCAGGGGCGAAGAAATTTCACCTGCACTGCACTCTGCAATAGAAGAATCAAAGATTTATGTCCTCGTTTTCTCCGAAAACTATGCATCTTCCACTTGGTGCTTGAATGAACTCACTAAGATACTTGATTGCAAGAAGAGATTTGGAAGGGATGTCATACCTGTTTTCTACAAGGTGGATCCATCAACTATTAGGAAGCAGGAACATAGATACAAAGAAGCATTCGATGAGCATGAGCAGCGGTTTAAGCACGACATGGACAAAGTACAAGGATGGAAGGATGCTCTAACCGAAGCTGCTGGACTTTCAGGCGTTGAAAAAATTGTGGAAGATATTTTGAGAAAATTGAATCGTTATTCCACCAGTTATGATCAAGGAATCATCGGCATTGAAAAAAATATTGGAGGAATTCAGTCCTTGTTGCATCTTGAGTCACCGGATGTTCGGATCATAGGCATTTGTGGCATGGGAGGAATAGGAAAAACTACAATTTGTGATCAAATATATCAGAAATTGGCATTGCAGTTTGATTCCAGCAGCCTTGTTTTAGACGTTCAAGACAAAATACAAAGAGATGGAATAGACAGTATCAGAACAAAATATCTGTCTGAGCTTCTAAAGGAAGAGAAATCCTCTTCTTCACCATATTACAATGAAAGGCTCAAACGGACAAAGGTTCTCCTCATTCTTGATGATGTTACCGATTCAGCTCAACTTCAAAAATTAATAAGAGGGAGTGATAGTTTTGGGCAGGGCAGTAGAATCATTATGACCAGTAGAGACAGACAAGTGCTTAGGAATGCTGGAGCTGATGATATCTACGAAGTTAAGGAGTTGAATTTGGATGATTCTCAGAAACTTTTTAATTTACATGCTTTTAAACAAAAATCTTCAGCAGAAAAATCTTACATGGACCTGTCAGAAGAGGTGTTGGGATATGCAGAAGGGATTCCGTTAGCTCTCCAGATTTTGGGGTCATTGCTTTATGGCAGAACAAGAGAAGCATGGGAGAGTGAGTTGCAAAAGTTGAAAAAGGGTCAACATCTTGGTATTTTCAATGTATTAAAATTAAGTTATGATGGGCTGGAGGAGGAGGAGAAGAATATATTTCTTGACATAGCTTGCTTTTATAGAGGTCACAACGAGATTGCGGTAGCAGAAAGACTTGATGACTTTGGTTTCTCTTCTAAGATTGGAATGGATATTCTCAAAGATAGGGGCCTAATATCTGTCATTGATGGTAGAATTGTGATGCACGATCTAATACAAGAAATGGGTAAAGAAATTGTTCGTAAAGAGTGTCCTCAGCATCCTGGAAAACGCAGCCGATTGTTTAATGCTGAGGAAATTTGTGAGGTTTTAAGAAAGAATGAAGGTGTACCCTCAAACTTTCAAAATCTCAAGAGGCTCTGTCACTTAGATCTCTCTCACTGTTCTTCCCTTACAATCTTTCCATTTGACCTTTCTCATATGAAGTTCCTAAAGCAACTTTCTCTCCGTGGTTGCTCAAAATTGGAAAATTTACCCCAGATTCAGGACACGTTGGAAGATCTAGTGGTGCTCATCTTAGACGGCACAGCCATACAGGCACTACCTTCATCCTTGTGCCGTTTGGTAGGGCTTCAAGAACTGAGTTTGTGCAGTTGCTTGAATCTTGAGATTATTCCATCTTCCATTGGAAGCCTCACCAGACTATGCAAGTTAGACCTTACCCACTGTAGTTCACTTCAAACTTTTCCAAGCACCATTTTCAATTTGAAGTTGAGGAACCTTGATTTGTGTGGTTGCTCAAGTCTGAGGACCTTCCCAGAGATCACAGAGCCGGCTCCTACTTTTGATCACATTAACTTGATATGTACGGCTGTTAAAGAACTGCCTTCCTCATTTGCCAATTTGGTTAATCTTCGATCCCTGGAGCTCCGCAAATGCACTGATCTCGAGTCACTTCCAAACTCCATTGTTAATCTCAAGCTTCTCTCTAAACTTGATTGTTCGGGGTGTGCCAGATTAACAGAAATCCCTAGAGACATCGGTCGCTTGACGTCATTAATGGAACTGTCACTGTGTGATAGCGGAATCGTGAACCTTCCTGAGAGCATT


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Phaseolus vulgaris].

MSGSSSSFPVSTSLTKHDVFLSFRGEDTRDNFISHLYAALQRKNIEAYIDYRLLRGEEISPALHSAIEESKIYVLVFSENYASSTWCLNELTKILDCKKRFGRDVIPVFYKVDPSTIRKQEHRYKEAFDEHEQRFKHDMDKVQGWKDALTEAAGLSGVEKIVEDILRKLNRYSTSYDQGIIGIEKNIGGIQSLLHLESPDVRIIGICGMGGIGKTTICDQIYQKLALQFDSSSLVLDVQDKIQRDGIDSIRTKYLSELLKEEKSSSSPYYNERLKRTKVLLILDDVTDSAQLQKLIRGSDSFGQGSRIIMTSRDRQVLRNAGADDIYEVKELNLDDSQKLFNLHAFKQKSSAEKSYMDLSEEVLGYAEGIPLALQILGSLLYGRTREAWESELQKLKKGQHLGIFNVLKLSYDGLEEEEKNIFLDIACFYRGHNEIAVAERLDDFGFSSKIGMDILKDRGLISVIDGRIVMHDLIQEMGKEIVRKECPQHPGKRSRLFNAEEICEVLRKNEGVPSNFQNLKRLCHLDLSHCSSLTIFPFDLSHMKFLKQLSLRGCSKLENLPQIQDTLEDLVVLILDGTAIQALPSSLCRLVGLQELSLCSCLNLEIIPSSIGSLTRLCKLDLTHCSSLQTFPSTIFNLKLRNLDLCGCSSLRTFPEITEPAPTFDHINLICTAVKELPSSFANLVNLRSLELRKCTDLESLPNSIVNLKLLSKLDCSGCARLTEIPRDIGRLTSLMELSLCDSGIVNLPESI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
5-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSSFPVSTSLTKHDVFLSFRGEDTRDNFISHLYAALQRKNIEAYIDYRLLRGEEISPALHSAIEESKIYVLVFSENYASSTWCLNELTKILDCKKRFGRDVIPVFYKVDPSTIRKQEHRYKEAFDEHEQRFKHDMDKVQGWKDALTEAAGLSGV

ProfileScan: PS50104
IPR000157
15-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TKHDVFLSFRGEDTRDNFISHLYAALQRKNIEAYIDYRLLRGEEISPALHSAIEESKIYVLVFSENYASSTWCLNELTKILDCKKRFGRDVIPVFYKVDPSTIRKQEHRYKEAFDEHEQRFKHDMDKVQGWKDALTEAAGL

Gene3D: G3DSA:3.40.50.10140
15-149 G3DSA:3.40.50.10140

TKHDVFLSFRGEDTRDNFISHLYAALQRKNIEAYIDYRLLRGEEISPALHSAIEESKIYVLVFSENYASSTWCLNELTKILDCKKRFGRDVIPVFYKVDPSTIRKQEHRYKEAFDEHEQRFKHDMDKVQGWKDAL

HMMSmart: SM00255
IPR000157
16-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHDVFLSFRGEDTRDNFISHLYAALQRKNIEAYIDYRLLRGEEISPALHSAIEESKIYVLVFSENYASSTWCLNELTKILDCKKRFGRDVIPVFYKVDPSTIRKQEHRYKEAFDEHEQRFKHDMDKVQGWKDALTEAAGL

HMMPfam: PF01582
IPR000157
19-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRDNFISHLYAALQRKNIEAYIDYRLLRGEEISPALHSAIEESKIYVLVFSENYASSTWCLNELTKILDCKKRFGRDVIPVFYKVDPSTIRKQEHRYKEAFDEHEQRFKHDMDKVQGWKDALT

HMMPanther: PTHR11017:SF20
29-753 PTHR11017:SF20,SUBFAMILY NOT NAMED

RDNFISHLYAALQRKNIEAYIDYRLLRGEEISPALHSAIEESKIYVLVFSENYASSTWCLNELTKILDCKKRFGRDVIPVFYKVDPSTIRKQEHRYKEAFDEHEQRFKHDMDKVQGWKDALTEAAGLSGVEKIVEDILRKLNRYSTSYDQGIIGIEKNIGGIQSLLHLESPDVRIIGICGMGGIGKTTICDQIYQKLALQFDSSSLVLDVQDKIQRDGIDSIRTKYLSELLKEEKSSSSPYYNERLKRTKVLLILDDVTDSAQLQKLIRGSDSFGQGSRIIMTSRDRQVLRNAGADDIYEVKELNLDDSQKLFNLHAFKQKSSAEKSYMDLSEEVLGYAEGIPLALQILGSLLYGRTREAWESELQKLKKGQHLGIFNVLKLSYDGLEEEEKNIFLDIACFYRGHNEIAVAERLDDFGFSSKIGMDILKDRGLISVIDGRIVMHDLIQEMGKEIVRKECPQHPGKRSRLFNAEEICEVLRKNEGVPSNFQNLKRLCHLDLSHCSSLTIFPFDLSHMKFLKQLSLRGCSKLENLPQIQDTLEDLVVLILDGTAIQALPSSLCRLVGLQELSLCSCLNLEIIPSSIGSLTRLCKLDLTHCSSLQTFPSTIFNLKLRNLDLCGCSSLRTFPEITEPAPTFDHINLICTAVKELPSSFANLVNLRSLELRKCTDLESLPNSIVNLKLLSKLDCSGCARLTEIPRDIGRLTSLMELSLCDSGIVNLPESI

HMMPanther: PTHR11017
29-753 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RDNFISHLYAALQRKNIEAYIDYRLLRGEEISPALHSAIEESKIYVLVFSENYASSTWCLNELTKILDCKKRFGRDVIPVFYKVDPSTIRKQEHRYKEAFDEHEQRFKHDMDKVQGWKDALTEAAGLSGVEKIVEDILRKLNRYSTSYDQGIIGIEKNIGGIQSLLHLESPDVRIIGICGMGGIGKTTICDQIYQKLALQFDSSSLVLDVQDKIQRDGIDSIRTKYLSELLKEEKSSSSPYYNERLKRTKVLLILDDVTDSAQLQKLIRGSDSFGQGSRIIMTSRDRQVLRNAGADDIYEVKELNLDDSQKLFNLHAFKQKSSAEKSYMDLSEEVLGYAEGIPLALQILGSLLYGRTREAWESELQKLKKGQHLGIFNVLKLSYDGLEEEEKNIFLDIACFYRGHNEIAVAERLDDFGFSSKIGMDILKDRGLISVIDGRIVMHDLIQEMGKEIVRKECPQHPGKRSRLFNAEEICEVLRKNEGVPSNFQNLKRLCHLDLSHCSSLTIFPFDLSHMKFLKQLSLRGCSKLENLPQIQDTLEDLVVLILDGTAIQALPSSLCRLVGLQELSLCSCLNLEIIPSSIGSLTRLCKLDLTHCSSLQTFPSTIFNLKLRNLDLCGCSSLRTFPEITEPAPTFDHINLICTAVKELPSSFANLVNLRSLELRKCTDLESLPNSIVNLKLLSKLDCSGCARLTEIPRDIGRLTSLMELSLCDSGIVNLPESI

superfamily: SSF52540
163-396 SSF52540

EDILRKLNRYSTSYDQGIIGIEKNIGGIQSLLHLESPDVRIIGICGMGGIGKTTICDQIYQKLALQFDSSSLVLDVQDKIQRDGIDSIRTKYLSELLKEEKSSSSPYYNERLKRTKVLLILDDVTDSAQLQKLIRGSDSFGQGSRIIMTSRDRQVLRNAGADDIYEVKELNLDDSQKLFNLHAFKQKSSAEKSYMDLSEEVLGYAEGIPLALQILGSLLYGRTREAWESELQKL

HMMPfam: PF00931
IPR002182
184-434 NB-ARC,NBS
NB-ARC

EKNIGGIQSLLHLESPDVRIIGICGMGGIGKTTICDQIYQKLALQFDSSSLVLDVQDKIQRDGIDSIRTKYLSELLKEEKSSSSPYYNERLKRTKVLLILDDVTDSAQLQKLIRGSDSFGQGSRIIMTSRDRQVLRNAGADDIYEVKELNLDDSQKLFNLHAFKQKSSAEKSYMDLSEEVLGYAEGIPLALQILGSLLYGRTREAWESELQKLKKGQHLGIFNVLKLSYDGLEEEEKNIFLDIACFYRGHN

Gene3D: G3DSA:3.40.50.300
197-367 G3DSA:3.40.50.300

ESPDVRIIGICGMGGIGKTTICDQIYQKLALQFDSSSLVLDVQDKIQRDGIDSIRTKYLSELLKEEKSSSSPYYNERLKRTKVLLILDDVTDSAQLQKLIRGSDSFGQGSRIIMTSRDRQVLRNAGADDIYEVKELNLDDSQKLFNLHAFKQKSSAEKSYMDLSEEVLGYA

HMMSmart: SM00382
IPR003593
200-332 AAA,NBS
AAA+ ATPase domain

DVRIIGICGMGGIGKTTICDQIYQKLALQFDSSSLVLDVQDKIQRDGIDSIRTKYLSELLKEEKSSSSPYYNERLKRTKVLLILDDVTDSAQLQKLIRGSDSFGQGSRIIMTSRDRQVLRNAGADDIYEVKEL

FPrintScan: PR00364
IPR000767
203-218 DISEASERSIST
Disease resistance protein

IIGICGMGGIGKTTIC

FPrintScan: PR00364
IPR000767
273-287 DISEASERSIST
Disease resistance protein

RLKRTKVLLILDDVT

FPrintScan: PR00364
IPR000767
367-381 DISEASERSIST
Disease resistance protein

AEGIPLALQILGSLL

superfamily: SSF46785
402-508 SSF46785

LGIFNVLKLSYDGLEEEEKNIFLDIACFYRGHNEIAVAERLDDFGFSSKIGMDILKDRGLISVIDGRIVMHDLIQEMGKEIVRKECPQHPGKRSRLFNAEEICEVLR

superfamily: SSF52058
470-751 SSF52058,LRR

VMHDLIQEMGKEIVRKECPQHPGKRSRLFNAEEICEVLRKNEGVPSNFQNLKRLCHLDLSHCSSLTIFPFDLSHMKFLKQLSLRGCSKLENLPQIQDTLEDLVVLILDGTAIQALPSSLCRLVGLQELSLCSCLNLEIIPSSIGSLTRLCKLDLTHCSSLQTFPSTIFNLKLRNLDLCGCSSLRTFPEITEPAPTFDHINLICTAVKELPSSFANLVNLRSLELRKCTDLESLPNSIVNLKLLSKLDCSGCARLTEIPRDIGRLTSLMELSLCDSGIVNLPE

Gene3D: G3DSA:3.80.10.10
510-652 G3DSA:3.80.10.10

NEGVPSNFQNLKRLCHLDLSHCSSLTIFPFDLSHMKFLKQLSLRGCSKLENLPQIQDTLEDLVVLILDGTAIQALPSSLCRLVGLQELSLCSCLNLEIIPSSIGSLTRLCKLDLTHCSSLQTFPSTIFNLKLRNLDLCGCSSL

FPrintScan: PR00364
IPR000767
518-534 DISEASERSIST
Disease resistance protein

QNLKRLCHLDLSHCSSL

HMMPfam: PF00560
IPR001611
523-544 LRR_1
Leucine-rich repeat

LCHLDLSHCSSLTIFPFDLSHM

Gene3D: G3DSA:3.80.10.10
653-751 G3DSA:3.80.10.10

RTFPEITEPAPTFDHINLICTAVKELPSSFANLVNLRSLELRKCTDLESLPNSIVNLKLLSKLDCSGCARLTEIPRDIGRLTSLMELSLCDSGIVNLPE

HMMPfam: PF00560
IPR001611
712-733 LRR_1
Leucine-rich repeat

LSKLDCSGCARLTEIPRDIGRL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox