PRGDB00046911 (Disease resistance protein)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 57634402 (AC149050)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula chromosome 7 BAC clone mth2-6j14, complete sequence.

DNA Sequence

ATGAGAAAAGATAAAAAGGTTCTAATTGTCCTTGATGATGTGTGGGATATTCTAGACTTTGAGTGTATTGGACTTCCTTATCTAGAACATGAGAAATATTGCAAAATATTGCTCACATCACGGGATGAAAAAGTGTGCAAAAACTTGGGATGCAATGTGAATTTTCAAGTTTCTGTGTTGTCGGAGGATGAGGCTTGGTATCTATTTCGAGAGATGTCAGGTGGAATTGTAGATACATATGATATCAACCCAATAGCAAGTGAGGTTGCAAAGGAATGTGGTGGCTTGCCTCTTGCAATTGTGACAGTTGGAAGAGCACTAAGTAATGAAGGGAAGTCGGCATGGGAGGATGCACTTAGACATTTAAGAAATTTTCAATCATCTCCCTTCTCAGACGTTGGAAAATTTGTCTACCCCAGCATTGAGCTTAGTTTAAAGTTTTTGGACAGCAGAGAACATAAGCTCTTCCTTATGCTTTGTGGATTGTATCCAGAAGACTTTGACATTCCCATTGAAAGTTTATTGTGTCATGGTTTTGGCTTGGGTCCGTTCAAAGACATCAGTGCATCATGGGAAGCAAGAAATCGAGTGCATACATTGGTGGAAGATCTAAGGAGAAAGTTTTTATTGTTGGATAGCAGTGTGCCAGGGTGTGTGAAGATGCATGATATTGTGCGTAATGTTGTTATATCAGTAGCATTTAAAAATGCAGAAGATAAATTCATGGTAAAGTACACCTTTAAGAGTCTAAAAGAAGAGAAATTGAACGAGATCAATGCAATATCACTTATTTTGGATGATACTAAAGAGTTAGAAAATGGCTTACACTGTCCGACACTTAAAATTTTACAAGTAAGTTCAAAAAGCAAGGAACCAATGTTTTGGCCTGAACTTTTCTTCCAAAGCATGAGCACACTTAAAGTTTTATCCATGAAAAATTTATGCATTCCAAAACTGCCATATTTATCCCAAGCTTCAGTCAATCTCCACACATTGCAAGTAGAACACTGTGATGTTGGAGATATATCTATAATCGGTAAGGAACTTAAACACCTAGAAGTCCTAAGTTTTGCACATTCTAATATTAAAGAACTCCCAATTGAAATAGGAAATCTGGGCAGTGTAAGATTATTAGATTTGTCAAATTGCAATGATCTTGACATCATTTCTGATAATATCTTGATAAGATTGTCTCGGTTGGAAGAACTTTACTATAGAATAGACAATTTTCCTTGGAAAAGAAATGAAGTTGCGCTCAACGAATTGAAAAAAATATCTCATCAGCTAAAGGTTGTTGAGATAAAATTTAGGGGGGCTGAAAGTTTAGTCAAGGATTTGGACTTCAAAAACTTGCAAAAGTTTTGGGTTTATGTGGATCCATACACTGATTTTCAACGATCTTTATATTTGGACTCAACTTTATTGCAAGTTAGTGGTATAGGCTATCAATCTATTGGTAGCATATTGATGATCTCACAATTGATTAAGAAATGTGAAATCCTCGTAATAAGAAATGTGAAAGCCTTGAAAAATGTTATGCCACAAATGTCACCTGATTGTCCAATTCCATGCTTGAAAGATTTAAGGGTTGATTCATGTCCAGATCTAAATACTCCCTTCACTCACTATTATAAGAAAAGAAAGAAAAAAAAAACCACTTTTTAG


Protein sequences

Name Description Sequence
Disease resistance protein Disease resistance protein [Medicago truncatula].

MRKDKKVLIVLDDVWDILDFECIGLPYLEHEKYCKILLTSRDEKVCKNLGCNVNFQVSVLSEDEAWYLFREMSGGIVDTYDINPIASEVAKECGGLPLAIVTVGRALSNEGKSAWEDALRHLRNFQSSPFSDVGKFVYPSIELSLKFLDSREHKLFLMLCGLYPEDFDIPIESLLCHGFGLGPFKDISASWEARNRVHTLVEDLRRKFLLLDSSVPGCVKMHDIVRNVVISVAFKNAEDKFMVKYTFKSLKEEKLNEINAISLILDDTKELENGLHCPTLKILQVSSKSKEPMFWPELFFQSMSTLKVLSMKNLCIPKLPYLSQASVNLHTLQVEHCDVGDISIIGKELKHLEVLSFAHSNIKELPIEIGNLGSVRLLDLSNCNDLDIISDNILIRLSRLEELYYRIDNFPWKRNEVALNELKKISHQLKVVEIKFRGAESLVKDLDFKNLQKFWVYVDPYTDFQRSLYLDSTLLQVSGIGYQSIGSILMISQLIKKCEILVIRNVKALKNVMPQMSPDCPIPCLKDLRVDSCPDLNTPFTHYYKKRKKKKTTF

Domains

Domain Start-End Description Sequence

FPrintScan: PR00364
IPR000767
1-15 DISEASERSIST
Disease resistance protein

MRKDKKVLIVLDDVW

superfamily: SSF52540
2-122 P-loop containing nucleoside triphosphate hydrolases

RKDKKVLIVLDDVWDILDFECIGLPYLEHEKYCKILLTSRDEKVCKNLGCNVNFQVSVLSEDEAWYLFREMSGGIVDTYDINPIASEVAKECGGLPLAIVTVGRALSNEGKSAWEDALRHL

Seg: seg
3-19 seg

KDKKVLIVLDDVWDILD

HMMPfam: PF00931
IPR002182
3-174 NB-ARC,NBS
NB-ARC

KDKKVLIVLDDVWDILDFECIGLPYLEHEKYCKILLTSRDEKVCKNLGCNVNFQVSVLSEDEAWYLFREMSGGIVDTYDINPIASEVAKECGGLPLAIVTVGRALSNEGKSAWEDALRHLRNFQSSPFSDVGKFVYPSIELSLKFLDSREHKLFLMLCGLYPEDFDIPIESL

FPrintScan: PR00364
IPR000767
93-107 DISEASERSIST
Disease resistance protein

CGGLPLAIVTVGRAL

superfamily: SSF52058
220-409 L domain-like,LRR

KMHDIVRNVVISVAFKNAEDKFMVKYTFKSLKEEKLNEINAISLILDDTKELENGLHCPTLKILQVSSKSKEPMFWPELFFQSMSTLKVLSMKNLCIPKLPYLSQASVNLHTLQVEHCDVGDISIIGKELKHLEVLSFAHSNIKELPIEIGNLGSVRLLDLSNCNDLDIISDNILIRLSRLEELYYRIDN

Gene3D: G3DSA:3.80.10.10
267-534 no description

DTKELENGLHCPTLKILQVSSKSKEPMFWPELFFQSMSTLKVLSMKNLCIPKLPYLSQASVNLHTLQVEHCDVGDISIIGKELKHLEVLSFAHSNIKELPIEIGNLGSVRLLDLSNCNDLDIISDNILIRLSRLEELYYRIDNFPWKRNEVALNELKKISHQLKVVEIKFRGAESLVKDLDFKNLQKFWVYVDPYTDFQRSLYLDSTLLQVSGIGYQSIGSILMISQLIKKCEILVIRNVKALKNVMPQMSPDCPIPCLKDLRVDSCP

FPrintScan: PR00364
IPR000767
370-386 DISEASERSIST
Disease resistance protein

GNLGSVRLLDLSNCNDL

Seg: seg
384-400 seg

NDLDIISDNILIRLSRL

Seg: seg
545-551 seg

KKRKKKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox