PRGDB00046912 (Disease resistance protein; Calcium-binding EF-hand; AAA ATPase)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein; Calcium-binding EF-hand; AAA ATPase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 57634402 (AC149050)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula chromosome 7 BAC clone mth2-6j14, complete sequence.

DNA Sequence

GTGGAATTACAAAAATTAGAGACATTTAGAGATATAGATGAAGAGCTTGTTGGCTACATCAAAAGAGTAACAAATCTTGACATTGTAAAGTTTAACAAGCTATTGAATTGCATTCCATCCAACATGATGCAATTATTCTCACATGTGAAGTCTCTAACAGTGAAAGAATGTGAGTGCTTAGTAGAGATATTTGAATCAAATGATAGCATCTTGCAGTGTGAACTAGAGGTCTTAGAAATAGAATTGTTTTCTCTTCCAAAACTGAAGCACATATGGAAAAATCATGGTCAAACTTTAAGGTTCGGGTGTTTAGAAGAGATAAGGATCAAGAAGTGCAATGATTTGGAATATGTGATTCCGGATGTTTCCGTGGTCACAAGCCTTCCAAGTTTGGTGTCGATTCGTGTGTCTGAATGCGAGAAGATGAAGGAGATCATTAGGAATAATTGTTCACAACAGAAAGCTAAGATTAAATTTCCAATATTGGAGGAAATATTACTAGAGAAGCTTCCTAGCCTCAAATGTTTCAGTGAAAGCTATTTCCCTTGCTATGTTGAGATGCCAAAATGTGAGTTGATAGTAATTAATGACTGCCCAGAGATGAAGACCTTTTGGTACGAAGGAATCTTATACACTCCAGGTCTTGAAGAGATTTATGTAGAAAATACTAAATTTGACAAAGATGAAGATGTTAATGAAGTGATACAACGACAGAATAAATGAGATTTAGTGCTTCGTGAAGTACCAGAGCTCAAGTGTTTTTGTTCAGGAGCGTACGACTATGATATCATGGTGTCGTCAACTAATGAGTATCCAAATACGACAACCTTTCCCCATGGAAACGTTGTTGTAAACACACCCATCCTTCGTAAACTAGACTGGAATCGAATTTATATAGATGCACTCGAAGACCTTAATTTGACAATATATTATCTTCAAAATTCAAAGAAATACAAGGTGGAATTGAAAAGTTCTGAGATGTTGAACTGGAAGGAGCTAATTGATAAAGACATGTTTGGATACTTTTCCAAAGAAGGGGCAATATACATCAGAGAATTTCGTAGATTATCAATGCTTGTACCATTCAGTGAGATACAAATGCTTCAACATGTAAGGATACTCGGTGTAGGTGACTGTGATTCATTGGTTGAGGTGTTTGAATCAGAAGGAGAATTTACAAAAAGGGGTGTCGCTACACATTATCATCTACAAAAGATGACACTGGAATATTTGCCAAGATTGAGTCGCATATGGAAACACAATATCACAGAGTTTGTAAGCTTTCAGAATCTAACAGAAATTGAAGTTTCTGATTGCCGCAATTTGAGGAGTTTGCTCTCCCATTCTATGGCTAGAAGCCTTGTGCAACTTCAAAAAATAGTAGTTGTTAGATGTGGAATCATGGAGGAGATAATAACAATAGAAGGGGAATCTATAGAAGGAGGCAACAAAGCTCCTTCTGTTTCTGAAACAAAACTCGAGATAGAGTTGGGTGGTGCACCTCTTCTTGAAGATCTTTATGTAAACTATTGTGGTTTGCAAGGGATGGATAAAACAAGGATAAGAAGCGCGCCAGTTATAGACGGACACTTGTTCCCATACTTAAAATCACTAATCATGGAGAGCTGTAACAAAATAAGTGTCTTGTTATCTTTTTCGTCTATGAGATATCTTGAGCGTCTAGAGAAGCTACACGTATTGAATTGCAGAAACTTAAATGAGATAGTATCTCAAGAAGAATCAGAATCAAGTGAAGAAAAGATTGTGTTCCCAGCATTGCAAGATCTGCTTCTTGAAAACCTTCCAAACCTTAAGGCTTTCTTCAAAGGACCCTGTAATCTTGATTTTCCATCACTACAAAAAGTGGACATCACAGATTGCCCTAATATGGAATTGTTTTCACGAGGACTTTGTAGTGCACAGAATCTTGAGGATATCAACATATGTCAGAATGAATTATGCATCACCAGCTACATAAATAAGAATGACATGAATGCCACTATACAAAGATCTAAAGCATGTGTAAAAAGAATTAGTTGTGATAAATCTGAACTAACAAGGGTCGAGGAAGGTGTGCTATCAATGAGTGGCAAGTTGTTTTCATCTGATTGGATGCAACATTTCCCAAAATTGGAAACAATCTTGCTACAAAATTGTTCTTCCATTAATGTGGTCTTTGACACTGAAAGATATTTAGATGGCCAAGTATTTCCACAATTGAAAGAACTGGAGATATCTCACCTTAATCAACTAACACATGTCTGGAGTAAAGCTATGCATTGTGTTCAAGGTTTTCAAAATTTGAAAACTTTGACAATATCAAATTGTGACTCTCTGAGACAAGTATTTACTCCAGCTATTATTGGAGCAATCACCAATATTGAGGAATTGGAGATACAATCTTGTAAGTTGATGGAGTATTTAGTGACAGATGATGAAGATGGTGATGAAGGTGACCATATTAATAAAGAGGAAGTAAATATTATCTCGTTTGAAAAATTAGATTCCTTAACACTTTCAAGACTCCCAAGTATAGCACATGTTTCTGCAAATTCTTACAAGATAGAATTTCCATCCTTAAGAAAGTTGGTAATTGATGATTGTCCAAAGCTAGATACATTGCTTTTGCTATGTGCATATACAAAGCACACAAATCATTCCACTGCATCATATTTAAATCTTGATGGCACTGGTGTTAGCCATTTTGAAGAAAACAACCCAAGATCTTCTAATTTTCATTCTGGTTGTACGCCGCTGTGTTCTAAATTGATTCGACAAAGCAAAAAAAATAACAAAATCAACAAGATGGAGTTTCTTACTGAACTATCAAAAGAAGCTGTCTCAAAACTTGGAGAATTGGCAGTGCAGTCTACAGTGAAGCAGTTTGAATATGTGATCCAGCACAAACAAATTATTGCCGACTTGAAGGAAGAACACAATAAGTTGAAGGGTGTCAAAGAAGCTCTACAAGCATGGGTTGACACAAAAAGAATGAATAGAGAAGGAACTGAACCTAACATAGAAAAGTGGCTCAATGACGTTGCAGCATTTGAAAATGTGTTACAAAGTTTCTACGAAGAAAAAGTTAAGATGAACAAGAAATGTTTTGGTGGAAAGTGTCCAAATTTGACATATAATTACTCATTGGGAAAGCAAGCCTCTAAAAGCATTGAATATATTATAAGGTTGAAGGAGGAAAAAAATGAATTCCAGCTCATATCCTACCATAAAGCTCCACCAACTCTTGGATCCACCTTCACTGAAGATATTAAGAGCTTGGAGTCTAGGAAGATAATCATAAAAGGAGTCATAGAGAAACTGAAGGATGATAAGTTCAAAAGAATAAGCATATGTGGAATGGGTGGAGTGGGAAAAACCACTCTGGTAAAAGAAATCATCAAATCTGTAGAAAATAAGTTATTTGATAAAGTTGTGATGGCAGTGATATCCCAAAATCCTGATTACAAGTATATCCAAAGTCAAATTGCTGATTGTTTAGGCTTGAGTTTGAAAAGTGAAAGTGTGGATGGAAGAGGCAGGGAATTAATTCATAGGTTGAAGGAAATCGATGATGATGGAAAGATTAAAGTCCTAGTTGTGCTCGATGATGTGTGGAGTGAGCTTAATTTTGATTGGGTGGGACTTCCATCTCGAGATAATCAAAAATGTAGCAAAATAATATTCACATCACGAAATGAAAAGGAATGTCAAAAGATGGGAAGCCAAGTGAATTTTCATGTTTCTATTTTGCTTAAGGATGAAGCCTGGTATCTGTTTCAATCAATGGCAGGTGATGTTGTATATGAACCTCGTATTTATCCAATAGCAAAACAAGTTGCAAAGGAATGTGGAGGCTTGCCTCTTGCTATTGTAATTGTTGGAAAAGCACTTGAAAATGAGAAAAAGCTTAGTGCATGGGAGGATGCATTTGAACAATTACAAAATTCACAATCATCTTCCTTCTCAGATGTTCACAATTTTGTTTACTCACGCATCGAACTTAGTTTCAAATTTTGGGGTAGCACAGAACACAAGAAATTCCTTATGCTTTGTGGATTGTTTCCGGAAGACTTTGACATACCTATTGAAAGTTTATTATGTCACGCAATGGGCTTGGGATTGTTCAAAGCTATCGGTGAGCCATGGAAAGCAAGAAACCGAGTGAATAGTTTTGTGGACGATCTAAAGAGATGCTTCTTGTTGTTGGATAGCAATGTCCCAGGGTGTGTGAAGATACATGATATTGTACGTGATGTTGTCATATTAGTTGCATTTAAAATAGAACATGGGTTTATGGTGAGATATGACATGAAGAGTTTGAAAGAAGAGAAATTAAATGACATCAGTGCATTATCACTTATCTTGAATGAGACGGTAGGGTTAGAAGACAACTTAGAGTGTCCTACCCTTCAGCTTCTACAAGTTAGATCAAAAGAAAAGAAACCAAACCATTGGCCGGAACATTTCTTCCAATGCATGAAATCACTCAAAGTTTTGTCTATGCAAAATGTGTACATTCCAAAACTTCCATCTCTATCTCAAGTCTCAGTTAGCCTCCATATGCTGCTATTAGAATATTGTGATGTTGGAGATATATCTATAATTGGTAAGGAACTTATACACCTAGAAGTCTTAAGTTTTGCACACTCTAAAATTAAAGAACTTCCAGTTGAAATAGGAAACTTGAGCATTCTAAGATTATTGGATTTGACAAATTGCAATGATCTTAAAGTCATTTCTACTAATGTCTTGATAAGATTGTCTCGATTGGAAGAACTTTATTTAAGGATGGACAATTTTCCTTGGGAAAAAAATGAAATTGCGATCAATGAGTTGAAAAAGATATCTCATCAGCTAAAGGTTGTTGAGATGAAAGTCAGAGGGACTGAAATTTCAGTCAAGGACTTGAACTTATACAACCTACAAAAGTTTTGGATTTATGTGGATCTTTATAGTGATTTTCAGCGCTCTGCATATTTGGAGTCAAATTTATTGCAAGTCGGTGCTATAGATTATCAATCTATTAATAGCATATTGATGGTCTCACAATTGATTAAGAAATGTGAAATCCTTGCAATAAGAAAGGTGAAAAGCTTGAAAAATGTTATGCCACAAATGTCACCTGATTGTCCAATTCCATACTTGAAAGATTTAAGGGTTGATTCATGTCCTGATCTCCAACATCTGATAGATTGTAGTGTTCGTTGCAATGACTTTCCACAAATCCATTCATTGTCTTTGAAAAAACTTCAGAATTTGAAAGAGATGTGTTATACACATAATAACCATGAGGTCAAGGGAATGATAATTGACTTCTCATATTTTGTGAAATTGGAATTAATAGACCTCCCAAACTTGTTTGGCTTTAACAATGCTATGGATTTGAAAGAGCTCAATCAA


Protein sequences

Name Description Sequence
Disease resistance protein; Calcium-binding EF-hand; AAA ATPase Disease resistance protein; Calcium-binding EF-hand; AAA ATPase [Medicago truncatula].

MEFLTELSKEAVSKLGELAVQSTVKQFEYVIQHKQIIADLKEEHNKLKGVKEALQAWVDTKRMNREGTEPNIEKWLNDVAAFENVLQSFYEEKVKMNKKCFGGKCPNLTYNYSLGKQASKSIEYIIRLKEEKNEFQLISYHKAPPTLGSTFTEDIKSLESRKIIIKGVIEKLKDDKFKRISICGMGGVGKTTLVKEIIKSVENKLFDKVVMAVISQNPDYKYIQSQIADCLGLSLKSESVDGRGRELIHRLKEIDDDGKIKVLVVLDDVWSELNFDWVGLPSRDNQKCSKIIFTSRNEKECQKMGSQVNFHVSILLKDEAWYLFQSMAGDVVYEPRIYPIAKQVAKECGGLPLAIVIVGKALENEKKLSAWEDAFEQLQNSQSSSFSDVHNFVYSRIELSFKFWGSTEHKKFLMLCGLFPEDFDIPIESLLCHAMGLGLFKAIGEPWKARNRVNSFVDDLKRCFLLLDSNVPGCVKIHDIVRDVVILVAFKIEHGFMVRYDMKSLKEEKLNDISALSLILNETVGLEDNLECPTLQLLQVRSKEKKPNHWPEHFFQCMKSLKVLSMQNVYIPKLPSLSQVSVSLHMLLLEYCDVGDISIIGKELIHLEVLSFAHSKIKELPVEIGNLSILRLLDLTNCNDLKVISTNVLIRLSRLEELYLRMDNFPWEKNEIAINELKKISHQLKVVEMKVRGTEISVKDLNLYNLQKFWIYVDLYSDFQRSAYLESNLLQVGAIDYQSINSILMVSQLIKKCEILAIRKVKSLKNVMPQMSPDCPIPYLKDLRVDSCPDLQHLIDCSVRCNDFPQIHSLSLKKLQNLKEMCYTHNNHEVKGMIIDFSYFVKLELIDLPNLFGFNNAMDLKELNQVKRISCDKSELTRVEEGVLSMSGKLFSSDWMQHFPKLETILLQNCSSINVVFDTERYLDGQVFPQLKELEISHLNQLTHVWSKAMHCVQGFQNLKTLTISNCDSLRQVFTPAIIGAITNIEELEIQSCKLMEYLVTDDEDGDEGDHINKEEVNIISFEKLDSLTLSRLPSIAHVSANSYKIEFPSLRKLVIDDCPKLDTLLLLCAYTKHTNHSTASYLNLDGTGVSHFEENNPRSSNFHSGCTPLCSKLIRQSKKNNKINKAPSVSETKLEIELGGAPLLEDLYVNYCGLQGMDKTRIRSAPVIDGHLFPYLKSLIMESCNKISVLLSFSSMRYLERLEKLHVLNCRNLNEIVSQEESESSEEKIVFPALQDLLLENLPNLKAFFKGPCNLDFPSLQKVDITDCPNMELFSRGLCSAQNLEDINICQNELCITSYINKNDMNATIQRSKACVELKSSEMLNWKELIDKDMFGYFSKEGAIYIREFRRLSMLVPFSEIQMLQHVRILGVGDCDSLVEVFESEGEFTKRGVATHYHLQKMTLEYLPRLSRIWKHNITEFVSFQNLTEIEVSDCRNLRSLLSHSMARSLVQLQKIVVVRCGIMEEIITIEGESIEGGNKDLVLREVPELKCFCSGAYDYDIMVSSTNEYPNTTTFPHGNVVVNTPILRKLDWNRIYIDALEDLNLTIYYLQNSKKYKVELQKLETFRDIDEELVGYIKRVTNLDIVKFNKLLNCIPSNMMQLFSHVKSLTVKECECLVEIFESNDSILQCELEVLEIELFSLPKLKHIWKNHGQTLRFGCLEEIRIKKCNDLEYVIPDVSVVTSLPSLVSIRVSECEKMKEIIRNNCSQQKAKIKFPILEEILLEKLPSLKCFSESYFPCYVEMPKCELIVINDCPEMKTFWYEGILYTPGLEEIYVENTKFDKDEDVNEVIQRQNK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
4-1737 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LTELSKEAVSKLGELAVQSTVKQFEYVIQHKQIIADLKEEHNKLKGVKEALQAWVDTKRMNREGTEPNIEKWLNDVAAFENVLQSFYEEKVKMNKKCFGGKCPNLTYNYSLGKQASKSIEYIIRLKEEKNEFQLISYHKAPPTLGSTFTEDIKSLESRKIIIKGVIEKLKDDKFKRISICGMGGVGKTTLVKEIIKSVENKLFDKVVMAVISQNPDYKYIQSQIADCLGLSLKSESVDGRGRELIHRLKEIDDDGKIKVLVVLDDVWSELNFDWVGLPSRDNQKCSKIIFTSRNEKECQKMGSQVNFHVSILLKDEAWYLFQSMAGDVVYEPRIYPIAKQVAKECGGLPLAIVIVGKALENEKKLSAWEDAFEQLQNSQSSSFSDVHNFVYSRIELSFKFWGSTEHKKFLMLCGLFPEDFDIPIESLLCHAMGLGLFKAIGEPWKARNRVNSFVDDLKRCFLLLDSNVPGCVKIHDIVRDVVILVAFKIEHGFMVRYDMKSLKEEKLNDISALSLILNETVGLEDNLECPTLQLLQVRSKEKKPNHWPEHFFQCMKSLKVLSMQNVYIPKLPSLSQVSVSLHMLLLEYCDVGDISIIGKELIHLEVLSFAHSKIKELPVEIGNLSILRLLDLTNCNDLKVISTNVLIRLSRLEELYLRMDNFPWEKNEIAINELKKISHQLKVVEMKVRGTEISVKDLNLYNLQKFWIYVDLYSDFQRSAYLESNLLQVGAIDYQSINSILMVSQLIKKCEILAIRKVKSLKNVMPQMSPDCPIPYLKDLRVDSCPDLQHLIDCSVRCNDFPQIHSLSLKKLQNLKEMCYTHNNHEVKGMIIDFSYFVKLELIDLPNLFGFNNAMDLKELNQVKRISCDKSELTRVEEGVLSMSGKLFSSDWMQHFPKLETILLQNCSSINVVFDTERYLDGQVFPQLKELEISHLNQLTHVWSKAMHCVQGFQNLKTLTISNCDSLRQVFTPAIIGAITNIEELEIQSCKLMEYLVTDDEDGDEGDHINKEEVNIISFEKLDSLTLSRLPSIAHVSANSYKIEFPSLRKLVIDDCPKLDTLLLLCAYTKHTNHSTASYLNLDGTGVSHFEENNPRSSNFHSGCTPLCSKLIRQSKKNNKINKAPSVSETKLEIELGGAPLLEDLYVNYCGLQGMDKTRIRSAPVIDGHLFPYLKSLIMESCNKISVLLSFSSMRYLERLEKLHVLNCRNLNEIVSQEESESSEEKIVFPALQDLLLENLPNLKAFFKGPCNLDFPSLQKVDITDCPNMELFSRGLCSAQNLEDINICQNELCITSYINKNDMNATIQRSKACVELKSSEMLNWKELIDKDMFGYFSKEGAIYIREFRRLSMLVPFSEIQMLQHVRILGVGDCDSLVEVFESEGEFTKRGVATHYHLQKMTLEYLPRLSRIWKHNITEFVSFQNLTEIEVSDCRNLRSLLSHSMARSLVQLQKIVVVRCGIMEEIITIEGESIEGGNKDLVLREVPELKCFCSGAYDYDIMVSSTNEYPNTTTFPHGNVVVNTPILRKLDWNRIYIDALEDLNLTIYYLQNSKKYKVELQKLETFRDIDEELVGYIKRVTNLDIVKFNKLLNCIPSNMMQLFSHVKSLTVKECECLVEIFESNDSILQCELEVLEIELFSLPKLKHIWKNHGQTLRFGCLEEIRIKKCNDLEYVIPDVSVVTSLPSLVSIRVSECEKMKEIIRNNCSQQKAKIKFPILEEILLEKLPSLKCFSE

HMMPanther: PTHR23155
4-1737 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTELSKEAVSKLGELAVQSTVKQFEYVIQHKQIIADLKEEHNKLKGVKEALQAWVDTKRMNREGTEPNIEKWLNDVAAFENVLQSFYEEKVKMNKKCFGGKCPNLTYNYSLGKQASKSIEYIIRLKEEKNEFQLISYHKAPPTLGSTFTEDIKSLESRKIIIKGVIEKLKDDKFKRISICGMGGVGKTTLVKEIIKSVENKLFDKVVMAVISQNPDYKYIQSQIADCLGLSLKSESVDGRGRELIHRLKEIDDDGKIKVLVVLDDVWSELNFDWVGLPSRDNQKCSKIIFTSRNEKECQKMGSQVNFHVSILLKDEAWYLFQSMAGDVVYEPRIYPIAKQVAKECGGLPLAIVIVGKALENEKKLSAWEDAFEQLQNSQSSSFSDVHNFVYSRIELSFKFWGSTEHKKFLMLCGLFPEDFDIPIESLLCHAMGLGLFKAIGEPWKARNRVNSFVDDLKRCFLLLDSNVPGCVKIHDIVRDVVILVAFKIEHGFMVRYDMKSLKEEKLNDISALSLILNETVGLEDNLECPTLQLLQVRSKEKKPNHWPEHFFQCMKSLKVLSMQNVYIPKLPSLSQVSVSLHMLLLEYCDVGDISIIGKELIHLEVLSFAHSKIKELPVEIGNLSILRLLDLTNCNDLKVISTNVLIRLSRLEELYLRMDNFPWEKNEIAINELKKISHQLKVVEMKVRGTEISVKDLNLYNLQKFWIYVDLYSDFQRSAYLESNLLQVGAIDYQSINSILMVSQLIKKCEILAIRKVKSLKNVMPQMSPDCPIPYLKDLRVDSCPDLQHLIDCSVRCNDFPQIHSLSLKKLQNLKEMCYTHNNHEVKGMIIDFSYFVKLELIDLPNLFGFNNAMDLKELNQVKRISCDKSELTRVEEGVLSMSGKLFSSDWMQHFPKLETILLQNCSSINVVFDTERYLDGQVFPQLKELEISHLNQLTHVWSKAMHCVQGFQNLKTLTISNCDSLRQVFTPAIIGAITNIEELEIQSCKLMEYLVTDDEDGDEGDHINKEEVNIISFEKLDSLTLSRLPSIAHVSANSYKIEFPSLRKLVIDDCPKLDTLLLLCAYTKHTNHSTASYLNLDGTGVSHFEENNPRSSNFHSGCTPLCSKLIRQSKKNNKINKAPSVSETKLEIELGGAPLLEDLYVNYCGLQGMDKTRIRSAPVIDGHLFPYLKSLIMESCNKISVLLSFSSMRYLERLEKLHVLNCRNLNEIVSQEESESSEEKIVFPALQDLLLENLPNLKAFFKGPCNLDFPSLQKVDITDCPNMELFSRGLCSAQNLEDINICQNELCITSYINKNDMNATIQRSKACVELKSSEMLNWKELIDKDMFGYFSKEGAIYIREFRRLSMLVPFSEIQMLQHVRILGVGDCDSLVEVFESEGEFTKRGVATHYHLQKMTLEYLPRLSRIWKHNITEFVSFQNLTEIEVSDCRNLRSLLSHSMARSLVQLQKIVVVRCGIMEEIITIEGESIEGGNKDLVLREVPELKCFCSGAYDYDIMVSSTNEYPNTTTFPHGNVVVNTPILRKLDWNRIYIDALEDLNLTIYYLQNSKKYKVELQKLETFRDIDEELVGYIKRVTNLDIVKFNKLLNCIPSNMMQLFSHVKSLTVKECECLVEIFESNDSILQCELEVLEIELFSLPKLKHIWKNHGQTLRFGCLEEIRIKKCNDLEYVIPDVSVVTSLPSLVSIRVSECEKMKEIIRNNCSQQKAKIKFPILEEILLEKLPSLKCFSE

superfamily: SSF52540
139-386 P-loop containing nucleoside triphosphate hydrolases

SYHKAPPTLGSTFTEDIKSLESRKIIIKGVIEKLKDDKFKRISICGMGGVGKTTLVKEIIKSVENKLFDKVVMAVISQNPDYKYIQSQIADCLGLSLKSESVDGRGRELIHRLKEIDDDGKIKVLVVLDDVWSELNFDWVGLPSRDNQKCSKIIFTSRNEKECQKMGSQVNFHVSILLKDEAWYLFQSMAGDVVYEPRIYPIAKQVAKECGGLPLAIVIVGKALENEKKLSAWEDAFEQLQNSQSSSF

HMMPfam: PF00931
IPR002182
165-431 NB-ARC,NBS
NB-ARC

IKGVIEKLKDDKFKRISICGMGGVGKTTLVKEIIKSVENKLFDKVVMAVISQNPDYKYIQSQIADCLGLSLKSESVDGRGRELIHRLKEIDDDGKIKVLVVLDDVWSELNFDWVGLPSRDNQKCSKIIFTSRNEKECQKMGSQVNFHVSILLKDEAWYLFQSMAGDVVYEPRIYPIAKQVAKECGGLPLAIVIVGKALENEKKLSAWEDAFEQLQNSQSSSFSDVHNFVYSRIELSFKFWGSTEHKKFLMLCGLFPEDFDIPIESLL

Gene3D: G3DSA:3.40.50.300
173-272 no description

KDDKFKRISICGMGGVGKTTLVKEIIKSVENKLFDKVVMAVISQNPDYKYIQSQIADCLGLSLKSESVDGRGRELIHRLKEIDDDGKIKVLVVLDDVWSE

FPrintScan: PR00364
IPR000767
179-194 DISEASERSIST
Disease resistance protein

RISICGMGGVGKTTLV

FPrintScan: PR00364
IPR000767
256-270 DISEASERSIST
Disease resistance protein

DDGKIKVLVVLDDVW

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

CGGLPLAIVIVGKAL

superfamily: SSF52058
496-1087 L domain-like,LRR

FMVRYDMKSLKEEKLNDISALSLILNETVGLEDNLECPTLQLLQVRSKEKKPNHWPEHFFQCMKSLKVLSMQNVYIPKLPSLSQVSVSLHMLLLEYCDVGDISIIGKELIHLEVLSFAHSKIKELPVEIGNLSILRLLDLTNCNDLKVISTNVLIRLSRLEELYLRMDNFPWEKNEIAINELKKISHQLKVVEMKVRGTEISVKDLNLYNLQKFWIYVDLYSDFQRSAYLESNLLQVGAIDYQSINSILMVSQLIKKCEILAIRKVKSLKNVMPQMSPDCPIPYLKDLRVDSCPDLQHLIDCSVRCNDFPQIHSLSLKKLQNLKEMCYTHNNHEVKGMIIDFSYFVKLELIDLPNLFGFNNAMDLKELNQVKRISCDKSELTRVEEGVLSMSGKLFSSDWMQHFPKLETILLQNCSSINVVFDTERYLDGQVFPQLKELEISHLNQLTHVWSKAMHCVQGFQNLKTLTISNCDSLRQVFTPAIIGAITNIEELEIQSCKLMEYLVTDDEDGDEGDHINKEEVNIISFEKLDSLTLSRLPSIAHVSANSYKIEFPSLRKLVIDDCPKLDTLLLLCAYTKHTNHSTASYLNLDG

FPrintScan: PR00364
IPR000767
625-641 DISEASERSIST
Disease resistance protein

GNLSILRLLDLTNCNDL

Gene3D: G3DSA:3.80.10.10
762-848 no description

KSLKNVMPQMSPDCPIPYLKDLRVDSCPDLQHLIDCSVRCNDFPQIHSLSLKKLQNLKEMCYTHNNHEVKGMIIDFSYFVKLELIDL

Gene3D: G3DSA:3.80.10.10
884-1085 no description

LSMSGKLFSSDWMQHFPKLETILLQNCSSINVVFDTERYLDGQVFPQLKELEISHLNQLTHVWSKAMHCVQGFQNLKTLTISNCDSLRQVFTPAIIGAITNIEELEIQSCKLMEYLVTDDEDGDEGDHINKEEVNIISFEKLDSLTLSRLPSIAHVSANSYKIEFPSLRKLVIDDCPKLDTLLLLCAYTKHTNHSTASYLNL

superfamily: SSF52047
1134-1469 RNI-like,LRR

KLEIELGGAPLLEDLYVNYCGLQGMDKTRIRSAPVIDGHLFPYLKSLIMESCNKISVLLSFSSMRYLERLEKLHVLNCRNLNEIVSQEESESSEEKIVFPALQDLLLENLPNLKAFFKGPCNLDFPSLQKVDITDCPNMELFSRGLCSAQNLEDINICQNELCITSYINKNDMNATIQRSKACVELKSSEMLNWKELIDKDMFGYFSKEGAIYIREFRRLSMLVPFSEIQMLQHVRILGVGDCDSLVEVFESEGEFTKRGVATHYHLQKMTLEYLPRLSRIWKHNITEFVSFQNLTEIEVSDCRNLRSLLSHSMARSLVQLQKIVVVRCGIMEEII

Seg: seg
1221-1228 seg

EESESSEE

Seg: seg
1235-1246 seg

LQDLLLENLPNL

superfamily: SSF52058
1345-1783 L domain-like,LRR

IYIREFRRLSMLVPFSEIQMLQHVRILGVGDCDSLVEVFESEGEFTKRGVATHYHLQKMTLEYLPRLSRIWKHNITEFVSFQNLTEIEVSDCRNLRSLLSHSMARSLVQLQKIVVVRCGIMEEIITIEGESIEGGNKDLVLREVPELKCFCSGAYDYDIMVSSTNEYPNTTTFPHGNVVVNTPILRKLDWNRIYIDALEDLNLTIYYLQNSKKYKVELQKLETFRDIDEELVGYIKRVTNLDIVKFNKLLNCIPSNMMQLFSHVKSLTVKECECLVEIFESNDSILQCELEVLEIELFSLPKLKHIWKNHGQTLRFGCLEEIRIKKCNDLEYVIPDVSVVTSLPSLVSIRVSECEKMKEIIRNNCSQQKAKIKFPILEEILLEKLPSLKCFSESYFPCYVEMPKCELIVINDCPEMKTFWYEGILYTPGLEEIYVENTK

Gene3D: G3DSA:3.80.10.10
1358-1465 no description

PFSEIQMLQHVRILGVGDCDSLVEVFESEGEFTKRGVATHYHLQKMTLEYLPRLSRIWKHNITEFVSFQNLTEIEVSDCRNLRSLLSHSMARSLVQLQKIVVVRCGIM

Seg: seg
1463-1479 seg

GIMEEIITIEGESIEGG

Seg: seg
1681-1692 seg

VSVVTSLPSLVS

Seg: seg
1715-1733 seg

KIKFPILEEILLEKLPSLK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox