PRGDB00046913 (R)

From PRG Wiki
Jump to: navigation, search
R
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 40018851 (AY423270)
Gene Class Unknown
Domain Type
Gene Species Pinus sylvestris

Comment?

Pinus sylvestris disease resistance gene (R) mRNA, complete cds.

DNA Sequence

ATGGAGGTCCATTCTACTGTAAATCATGCTTCTGCAAAGCGTTTCTGGAACATTTTAAGGATCGCCCTCTTCATGATCAGGAAAGGCCTCATTTCCAAAAGAAAGATGCTCATGGACATGCATCTCATGATGGAACGAGGTAAAGTCTATGGAAGAAGCCTGAGGAATCTAGTGTTCCATCATTCCAGAGGCAACAATCATGGTGGGTTTGGGCTTCAAGATTATGAATTCTCCTGCAGTAACAGCCCTGCCATCTTCCATATGACCAAGAGAAAACATCATTACTTCCCCACACATATTCTGCACTTTCCATGCATTCATCCGCATCAAGTTGAAGACAAGGAAGAGCCCAGTACTCCTGTTTTTCCCCAGTTGGACTACAGCAATGAATACTTTAGCAAGGATTGCCTTGATCAAAACGATCTGCCAGTTCTCCAGAAACTGAGCCCGTTGTTGTCTCCTCTCTGTCGAAGGATATCCAATTCCGGTGAAGATCAAGCTTATGACCATCAAGTTGACAGGCGGGCCGACGAATTCATAGCTAAGTTCTATGAGCAACTGAGGCTGCAGAACCGGATGTCTTTGCTGCAGTATCAGGAGATGCTTGAAAGGGGTACAGCCTAA


Protein sequences

Name Description Sequence
disease resistance gene disease resistance gene [Pinus sylvestris].

MEVHSTVNHASAKRFWNILRIALFMIRKGLISKRKMLMDMHLMMERGKVYGRSLRNLVFHHSRGNNHGGFGLQDYEFSCSNSPAIFHMTKRKHHYFPTHILHFPCIHPHQVEDKEEPSTPVFPQLDYSNEYFSKDCLDQNDLPVLQKLSPLLSPLCRRISNSGEDQAYDHQVDRRADEFIAKFYEQLRLQNRMSLLQYQEMLERGTA

Domains

Domain Start-End Description Sequence

HMMPfam: PF05553
IPR008480
169-205 DUF761
Protein of unknown function DUF761, plant

DHQVDRRADEFIAKFYEQLRLQNRMSLLQYQEMLERG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox