PRGDB00046915 (RXW8)

From PRG Wiki
Jump to: navigation, search
RXW8
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18181929 (AB077822)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 1, P1 clone:X7J, complete sequence.

DNA Sequence

AATTCAAGGTTGATAAGGAAATGGAAATGATGGGTAAGCAAATGATTAAATATTGTGGAGGACTACCATTGGCCGTCAAAGTGTTGGGAGGGTTGTTAGCTGCAAAATACACTTTTCATGATTGGAAACGATTATCTGAGAATATTGGATGTCATATCGTGGGAAGAACCGATTTCAGTGACGGTAACAACAGTTCAGTTTACCATGTATTGTCTCTGAGCTTTGAAGAGTTGCCTAGTTATTTGAAGCATTGCTTCCTCTACTTGGCCCATTTTCCAGAAGATCATAACATAAAGGTAGAAAAATTGTCTTATTGTTGGGCTGCTGAAGGAATATTAGAACCTCGACATTACCATGGACAGACTATTCGAGATGTTGGAGAAAGCTACATAGAGGAGTTAGTGAGGAGAAATATGGTTATTGCCGAAAGAGATGTTACGACTTTGAGATTTGAAGCTTGTCATTTGCATGACATGATGAGAGAAGTTTGTTTGTTAAAAGCCAAAGAAGAGAACTTCGTTCAAATCGCAAGTATCCTCCCTCCAACCGCAAACTCGCAATATCCTGGTACATCTCGCAGATTTGTCTCACAAAATCCTACTACATTACATGTTAGTAGAGATATAAATAATCCAAAACTTCAATCTCTCCTTATTGTATGGGAGAACAGAAGAAAGAGTTGGAAGCTATTAGGTTCAAGCTTTATAAGGTTAGAACTACTGAGGGTATTAGATCTCTATAAAGCCAAGTTTGAAGGGAGAAATTTACCTTCTGGCATTGGAAAGCTCATCCACTTGAGATACTTGAACTTAGATTTGGCTCGTGTATCTCGTCTACCTTCTTCTCTAGGAAACCTAAGGTTGCTGATCTATCTAGACATAAATGTATGCACGAAATCTCTATTCGTGCCCAATTGCTTGATGGGGATGCATGAATTAAGATACCTTAGACTACCATTTAATACGTCGAAGGAGATAAAGTTGGGACTGTGTAATCTCGTAAACTTGGAGACCTTAGAGAATTTCTCAACAGAGAATAGCAGCTTAGAGGATCTTCGTGGTATGGTAAGTTTGAGGACTCTCACCATTGGTTTATTTAAGCACATTAGTAAAGAGACTCTGTTTGCATCAATACTTGGGATGAGGCACCTGGAAAATCTTAGCATAAGGACACCAGACGGGTCTTCAAAGTTTAAAAGGATAATGGAAGATGGAATCGTATTGGATGCCATTCATCTAAAACAATTGAATTTGAGGTTATATATGCCAAAGTTACCTGATGAACAACACTTCCCTTCTCACCTTACAAGCATATCTCTAGATGGTTGTTGTTTGGTGGAGGATCCGTTACCGATTCTAGAGAAATTACTTGAGTTGAAAGAGGTTCGTTTAGACTTTCGAGCTTTCTGTGGGAAGAGAATGGTTAGCTCGGACGGTGGGTTTCCTCAATTGCACAGGCTATATATATGGGGATTAGCTGAGTGGGAAGAGTGGATAGTAGAAGAAGGCTCCATGCCACGTCTTCATACTCTGACTATATGGAATTGTCAAAAATTAAAGCAGCTTCCTGATGGTTTGCGATTCATCTATTCTATAAAAGATTTGGATATGGACAAGAAATGGAAGGAAATATTGTCAGAAGGAGGAGAAGAATATTACAAAGTCCAACACATTCCTTCTGTTAAATTCGAAAAGGACTACAAATAAGTTGGAAGGTGTTGATTACATCTCGAACAGAGACTATCGCAATGCATGGAAATAGAAGATATGTCAACTTTAAACCAGAATGCCTAACTATTCTAGAGAGTTGGATACTTTTCCAAAGAATTGCAATGCCAAGGGTAGATGAATCAGATGGTCGAGGCAATTGTTTCATTTGGAGTAGAAAAGCTTTGGGACCGACTGACCCAAGAATACGAGCAATTTCAAGGAGTTGAAGATCGAATAGCTGAACTAAAAAGTAATCTAAACTTGTTAAAGTCCTTTTTGAAAGATGCAGAAGCCAAGAAAAATACAAGTCAGATGGTGCGACATTGTGTTGAAGAGATTAAAGAAATTGTTTATGATACGGAGAATATGATCGAAACGTTTATTCTCAAAGAAGCAGCCCGAAAAAGAAGTGGCATCATCAGGCGTATCACAAAACTAACTTGCATTAAAGTGCATCGTTGGGAATTTGCGTCCGATATTGGAGGCATAAGTAAGAGGATCTCTAAGGTGATTCAAGACATGCATAGTTTTGGAGTACAACAGATGATTTCCGATGGTAGTCAGTCTTCACATCTACTACAAGAAAGAGAAAGGGAGATGCGACAAACGTTTTCTAGGGGTTACGAAAGCGACTTTGTGGGGTTGGAGGTAAATGTTAAGAAACTGGTTGGATATTTGGTGGAGGAAGATGACATTCAAATTGTTTCGGTAACCGGGATGGGAGGTCTTGGTAAAACCACCCTTGCAAGACAAGTTTTTAACCATGAGGATGTTAAACATCAGTTTGATAGACTCGCATGGGTGTGTGTCTCACAAGAGTTTACTCGGAAAAATGTATGGCAAATGATCTTGCAGAATCTAACCTCTAGAGAAACGAAAGATGAAATCTTGCAAATGGAAGAAGCTGAACTCCATGATGAACTCTTTCAGCTATTGGAGACATCTAAATCATTAATTGTTTTTGATGACATATGGAAAGAAGAAGACTGGGGCCTAATCAATCCAATATTTCCACCAAAAAAAG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MVEAIVSFGVEKLWDRLTQEYEQFQGVEDRIAELKSNLNLLKSFLKDAEAKKNTSQMVRHCVEEIKEIVYDTENMIETFILKEAARKRSGIIRRITKLTCIKVHRWEFASDIGGISKRISKVIQDMHSFGVQQMISDGSQSSHLLQEREREMRQTFSRGYESDFVGLEVNVKKLVGYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKEEDWGLINPIFPPKKGWKVLITSRTETIAMHGNRRYVNFKPECLTILESWILFQRIAMPRVDESEFKVDKEMEMMGKQMIKYCGGLPLAVKVLGGLLAAKYTFHDWKRLSENIGCHIVGRTDFSDGNNSSVYHVLSLSFEELPSYLKHCFLYLAHFPEDHNIKVEKLSYCWAAEGILEPRHYHGQTIRDVGESYIEELVRRNMVIAERDVTTLRFEACHLHDMMREVCLLKAKEENFVQIASILPPTANSQYPGTSRRFVSQNPTTLHVSRDINNPKLQSLLIVWENRRKSWKLLGSSFIRLELLRVLDLYKAKFEGRNLPSGIGKLIHLRYLNLDLARVSRLPSSLGNLRLLIYLDINVCTKSLFVPNCLMGMHELRYLRLPFNTSKEIKLGLCNLVNLETLENFSTENSSLEDLRGMVSLRTLTIGLFKHISKETLFASILGMRHLENLSIRTPDGSSKFKRIMEDGIVLDAIHLKQLNLRLYMPKLPDEQHFPSHLTSISLDGCCLVEDPLPILEKLLELKEVRLDFRAFCGKRMVSSDGGFPQLHRLYIWGLAEWEEWIVEEGSMPRLHTLTIWNCQKLKQLPDGLRFIYSIKDLDMDKKWKEILSEGGEEYYKVQHIPSVKFEKDYK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF233
2-905 PTHR23155:SF233,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

VEAIVSFGVEKLWDRLTQEYEQFQGVEDRIAELKSNLNLLKSFLKDAEAKKNTSQMVRHCVEEIKEIVYDTENMIETFILKEAARKRSGIIRRITKLTCIKVHRWEFASDIGGISKRISKVIQDMHSFGVQQMISDGSQSSHLLQEREREMRQTFSRGYESDFVGLEVNVKKLVGYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKEEDWGLINPIFPPKKGWKVLITSRTETIAMHGNRRYVNFKPECLTILESWILFQRIAMPRVDESEFKVDKEMEMMGKQMIKYCGGLPLAVKVLGGLLAAKYTFHDWKRLSENIGCHIVGRTDFSDGNNSSVYHVLSLSFEELPSYLKHCFLYLAHFPEDHNIKVEKLSYCWAAEGILEPRHYHGQTIRDVGESYIEELVRRNMVIAERDVTTLRFEACHLHDMMREVCLLKAKEENFVQIASILPPTANSQYPGTSRRFVSQNPTTLHVSRDINNPKLQSLLIVWENRRKSWKLLGSSFIRLELLRVLDLYKAKFEGRNLPSGIGKLIHLRYLNLDLARVSRLPSSLGNLRLLIYLDINVCTKSLFVPNCLMGMHELRYLRLPFNTSKEIKLGLCNLVNLETLENFSTENSSLEDLRGMVSLRTLTIGLFKHISKETLFASILGMRHLENLSIRTPDGSSKFKRIMEDGIVLDAIHLKQLNLRLYMPKLPDEQHFPSHLTSISLDGCCLVEDPLPILEKLLELKEVRLDFRAFCGKRMVSSDGGFPQLHRLYIWGLAEWEEWIVEEGSMPRLHTLTIWNCQKLKQLPDGLRFIYSIKDLDMDKKWKEILSEGGEEYYKVQHIPSVKF

HMMPanther: PTHR23155
2-905 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VEAIVSFGVEKLWDRLTQEYEQFQGVEDRIAELKSNLNLLKSFLKDAEAKKNTSQMVRHCVEEIKEIVYDTENMIETFILKEAARKRSGIIRRITKLTCIKVHRWEFASDIGGISKRISKVIQDMHSFGVQQMISDGSQSSHLLQEREREMRQTFSRGYESDFVGLEVNVKKLVGYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKEEDWGLINPIFPPKKGWKVLITSRTETIAMHGNRRYVNFKPECLTILESWILFQRIAMPRVDESEFKVDKEMEMMGKQMIKYCGGLPLAVKVLGGLLAAKYTFHDWKRLSENIGCHIVGRTDFSDGNNSSVYHVLSLSFEELPSYLKHCFLYLAHFPEDHNIKVEKLSYCWAAEGILEPRHYHGQTIRDVGESYIEELVRRNMVIAERDVTTLRFEACHLHDMMREVCLLKAKEENFVQIASILPPTANSQYPGTSRRFVSQNPTTLHVSRDINNPKLQSLLIVWENRRKSWKLLGSSFIRLELLRVLDLYKAKFEGRNLPSGIGKLIHLRYLNLDLARVSRLPSSLGNLRLLIYLDINVCTKSLFVPNCLMGMHELRYLRLPFNTSKEIKLGLCNLVNLETLENFSTENSSLEDLRGMVSLRTLTIGLFKHISKETLFASILGMRHLENLSIRTPDGSSKFKRIMEDGIVLDAIHLKQLNLRLYMPKLPDEQHFPSHLTSISLDGCCLVEDPLPILEKLLELKEVRLDFRAFCGKRMVSSDGGFPQLHRLYIWGLAEWEEWIVEEGSMPRLHTLTIWNCQKLKQLPDGLRFIYSIKDLDMDKKWKEILSEGGEEYYKVQHIPSVKF

superfamily: SSF52540
148-399 SSF52540

REREMRQTFSRGYESDFVGLEVNVKKLVGYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKEEDWGLINPIFPPKKGWKVLITSRTETIAMHGNRRYVNFKPECLTILESWILFQRIAMPRVDESEFKVDKEMEMMGKQMIKYCGGLPLAVKVLGGLLAAKYTFHDWKRLSENIGCHIVGRT

HMMPfam: PF00931
IPR002182
169-459 NB-ARC,NBS
NB-ARC

VNVKKLVGYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKEEDWGLINPIFPPKKGWKVLITSRTETIAMHGNRRYVNFKPECLTILESWILFQRIAMPRVDESEFKVDKEMEMMGKQMIKYCGGLPLAVKVLGGLLAAKYTFHDWKRLSENIGCHIVGRTDFSDGNNSSVYHVLSLSFEELPSYLKHCFLYLAHFPEDHNIKVEKLSYCWAAEGILEPRH

Gene3D: G3DSA:3.40.50.300
176-279 G3DSA:3.40.50.300

GYLVEEDDIQIVSVTGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSRETKDEILQMEEAELHDELFQLLETSKSLIVFDDIWKE

FPrintScan: PR00364
IPR000767
186-201 DISEASERSIST
Disease resistance protein

IVSVTGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

LLETSKSLIVFDDIW

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CGGLPLAVKVLGGLL

superfamily: SSF52058
529-881 SSF52058,LRR

QYPGTSRRFVSQNPTTLHVSRDINNPKLQSLLIVWENRRKSWKLLGSSFIRLELLRVLDLYKAKFEGRNLPSGIGKLIHLRYLNLDLARVSRLPSSLGNLRLLIYLDINVCTKSLFVPNCLMGMHELRYLRLPFNTSKEIKLGLCNLVNLETLENFSTENSSLEDLRGMVSLRTLTIGLFKHISKETLFASILGMRHLENLSIRTPDGSSKFKRIMEDGIVLDAIHLKQLNLRLYMPKLPDEQHFPSHLTSISLDGCCLVEDPLPILEKLLELKEVRLDFRAFCGKRMVSSDGGFPQLHRLYIWGLAEWEEWIVEEGSMPRLHTLTIWNCQKLKQLPDGLRFIYSIKDLDMDK

Gene3D: G3DSA:3.80.10.10
568-700 G3DSA:3.80.10.10

KSWKLLGSSFIRLELLRVLDLYKAKFEGRNLPSGIGKLIHLRYLNLDLARVSRLPSSLGNLRLLIYLDINVCTKSLFVPNCLMGMHELRYLRLPFNTSKEIKLGLCNLVNLETLENFSTENSSLEDLRGMVSL

Gene3D: G3DSA:3.80.10.10
755-880 G3DSA:3.80.10.10

LKQLNLRLYMPKLPDEQHFPSHLTSISLDGCCLVEDPLPILEKLLELKEVRLDFRAFCGKRMVSSDGGFPQLHRLYIWGLAEWEEWIVEEGSMPRLHTLTIWNCQKLKQLPDGLRFIYSIKDLDMD

FPrintScan: PR00364
IPR000767
845-861 DISEASERSIST
Disease resistance protein

GSMPRLHTLTIWNCQKL


List of References

A Kato, M Suzuki, A Kuwahara, H Ooe, K Higano-Inaba, Y Komeda
Isolation and analysis of cDNA within a 300 kb Arabidopsis thaliana genomic region located around the 100 map unit of chromosome 1.
Gene: 1999, 239(2);309-16
PubMed:10548732 WorldCat.org (P p)

M Suzuki, A Kato, Y Komeda
An RNA-binding protein, AtRBP1, is expressed in actively proliferative regions in Arabidopsis thaliana.
Plant Cell Physiol.: 2000, 41(3);282-8
PubMed:10805591 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox