PRGDB00046917 (disease resistance protein)

From PRG Wiki
Jump to: navigation, search
disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3046850 (AB012242)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K24G6.

DNA Sequence

GTGCCTCAGCGTTTTGCTTGCTTATCTGGAAGTAGAGTGCCCATCTACTTCGACTATCAAGCAAGGGAATATTCCAGAGAAATCAGCATACCCCCAATATGGCATGCCTCTGAGTTTGTGGGTTTTGATGCCTGTATCATAATTGCTTGTCAGAGTCCTTATCACATAAAGCTCTCGTCATCTTCTTATAGCTGTAAACAGGAAGATAACCAGTCCTACCGAATTGACCTCAAGCCCGATTTCGTTCTCCCACCGGAGAGTACTCGTAGCAGCAATGACAAAGAGGCATTCTCAGCACATCACATGTTCATCTTCCACGTTCCAAGTAACGTAGACTTCAACGAGTTTAGCCTTGAGCCAAAACTTGTAATTTCAGAGGAGTTTCAGTCTACACCGGGCAGAATAATATCATACGGAGTTCGAGTAGTACTCAAAACTGAAGAGGATGATCGAAACTACGACATAAACTGCGGAAACCTATCCAAAAAAAGGAAAACAGATATGTTGACAATTTGATCGCTCTTGGAGTTAAGGATGCTAGATGTCACTGGATCTAAGAATCTGACCAAACTTCCAGATCTTTCAAGGGCAACAAAGCTTGAGGAGCTGATTGCTAAAGGTTGCACGAGGTTGGAGCAAATCCCGGAAACAATTGGTAGCTTACCTTCACTGAAGAAACTTGATGTATCCCACTGTGATCGCCTCATCAATCTTCAGATGATTATAGGAGAATTGCCTGCCCTTCAAAAACGTAGCCCAGGGCTTTTTCGGCAAGCTTCATTGAGTTTCCCAGATGCTGTAGTTACACTGAACTCTCTTACGAGTCTAGCCATCCATGGCAAATTAAATTTTTGGTTGTCACATCTCCGAGGAAAGGCAGACCACCTCTGCTTTAGTTCCGAGCAATGGACCCCTAACAAATTTCTGAAGCAAGTACAAAAGACGCCTAAGCTCATGTCTGAGTTTTACGGATTTAAATCACTCGACATCATGCAGTTCATCTACCGTAAAGACAGTGCCTCTTTCCAGTGTTATAGCTTTTCAGATTTCCTCTGGTTAACCGAGTTAAATCTCATAAACCTAAACATAGAAAGCATCCCAGATGACATTGGCCTTTTGCAGGTCCTACAAAAACTGGACCTCAGCGGAAATGATTTCACATGCCTACCCACAGATATGGAAAATCTTTCTAGTATGAAATCTCTCAGGCTTTGCAACTGCCTCAAACTTCAAACACTACCAAAACTACCTCAACTGGAGACACTCAAACTTTCTAACTGTATACTTCTCCAAAGTCCACTAGGACATTCAGCTGCCAGAAAAGATGAGCGTGGATACCGCTTAGCTGAGCTTTGGCTTGACAACTGCAATGATGTTTTTGAATTGTCATATACGTTTAGTCATTGCACCAATTTAACATACTTAGACCTCAGCGGAAATGATATGGTGACGATGCCTGTAACTATCAGATTCCTTAGGCTGTTGAATACTCTCTGCCTCAATGACTGCAAGAAACTCAAGTCAATGGTACAGCTTCCACCAAACCTTACATCTCTCTATGCACGTGGCTGCACTTCCCTGGAAATTATTCACCTTCCCTTGGATCATTCCATAAAACACGTTGATCTTAGCTACTGCCCCAAATTGAATGAAGTTGCGAATCTGATGGATCGATTTCTGAGATGTGGACGAAAGGAAGAGGGGACAGAGAGAATCCAAGGCATGACACTACATATGTGTGAATTGCCCCGAGCAGCATCCATAGATGGGAGTGCTTTTGAGCAGATGGAAAATCTCATATTTCTCAAATTCTTCAAACACTTAAATGATAGAGAGTCCAAGCTGAATATCAATTCAAAGAATCGTATGGTACTTCCACGCAGCCTTAGGCTATTGCATTGGGACGCATATCCATTAACAACCTTGCTTCCCACATTTCCTCTGAGTCGTCTTGTTGAACTTCATCTGCGTTACAGCAATCTGGAGAACCTGTGGGATGGAAAAATGTGCGGACGAGGCTATGATGCTTGAAGAAATTGTTGAAGTCATCTCAAGCCGGTTAGCTTCTATGCAAGCAACTTCTTTTGAAGATTTAGTTGGTATGGAAGCTCACATGGAAAACATAAGACCTCTCTTGAAGAAAGACTTTGATGCCGAGGTTTGTATGGTTGGAATATGGGGAATGGGGGGCATCGGAAAAACTACCATTGCTAAGTATCTATATGAACAGCTTGCAAGCCAATTTCCAGCTCATTCTTTCATTGAAGATGTCGGCCAAATCTGTAAGAAAGTTGATCTAAAATGTATACAACAACAACTTCTCTGCGATATTCTAAGTACAAAACGAGTGGCCTTGATGAGCATCCAAAACGGTGCAAACCTTATTCGGTCAAGGCTTGGAACCCTCAAGGTTCTCTTTGTGCTTGATGGTGTTGATAAAGTGGAGCAGTTACATGCCTTGGCAAAGGAGGCTAGCTGGTTTGGTCCAGGGAGCCGAATCATTATAACCACACGTGACAGAAGATTGCTAGATTCCTGCAGAGTGACCAACAAGTACGAGGTTAAATGCTTGCAAAATGAGGACTCGTTAAAGATTGTTAAAAATATTGCTTTTGCAGGCGGAGTTCCTACACTTGATGGATATGAACGTTTTGCGATTCGAGCATCTCAGCTCGCTCAAGGTCTTCCTTTAGCCCTGGTAGCTTTCGGTTCATTTCTCCGTGGAGCGACCTCTATAGACGAGTGGGAAGATGCAATAGACACGCTTGAAACAGCTCCTCACCAGAATATCATGGATATTTTAAGAAGTAGCTATACCAATCTGGACCTACGAGACAAGACCATTTTCATTAGGGTCGCATGTCTTTTCAATGGAGAACCAGTCTCCCGTGTTTCTACCCTTCTCTCTGAAACTAAAAGAAGGATAAAAGGTTTAGCTGAAAAGTCTCTCATCCATATATCAAAAGATGGATATATTGACATACATTCCTTGATAAAACAAATGGCTAGAGAAATTGTTGTTGAAGAATCATTGTACATACCTCGACAACAAAGAATTTTGTGGGATCCTCATAACAGTTATGGCGTACTGGAAAGCAAAACAATGGCTTCTTCGTCTTTGTCTTCACCTCCTCCCTGTAACTATGATGTCTTCCTAAGCTTCCGTGGGGAAGATACACGTAGAACCATTGTCAGCCATTTGTACGCAGCACTTGGTGCAAAGGGAATCATTACTTTCAAAGACGATCAAGATCTTGAGGTAGGTGATCATATTTCTAGCCACCTCCGCAGAGCCATAGAAGGTTCAAAGTTCGCTGTTGTGGTTCTCTCTGAAAGATACACAACGTCAAGGTGGTGCTTGATGGAACTGCAATTAATAATGGAATTGTACAACCTTGGTAAACTCAAAGTCCTTCCCTTGTTCTATGAAGTTGATCCCTCTGACGTGAGACACCAGCGAGGAAGTTTTGGTTTAGAAAGGTACCAGGGTCCAGAATTCGCGGATATTGTGCAAAGGTGGAGAGTAGCTCTGTGCATGGTAGCCAATCTCTCAGGCATGGTTTCCAGATATTG


Protein sequences

Name Description Sequence
disease resistance protein disease resistance protein [Arabidopsis thaliana].

MASSSLSSPPPCNYDVFLSFRGEDTRRTIVSHLYAALGAKGIITFKDDQDLEVGDHISSHLRRAIEGSKFAVVVLSERYTTSRWCLMELQLIMELYNLGKLKVLPLFYEVDPSDVRHQRGSFGLERYQGPEFADIVQRWRVALCMVANLSGMVSRYCADEAMMLEEIVEVISSRLASMQATSFEDLVGMEAHMENIRPLLKKDFDAEVCMVGIWGMGGIGKTTIAKYLYEQLASQFPAHSFIEDVGQICKKVDLKCIQQQLLCDILSTKRVALMSIQNGANLIRSRLGTLKVLFVLDGVDKVEQLHALAKEASWFGPGSRIIITTRDRRLLDSCRVTNKYEVKCLQNEDSLKIVKNIAFAGGVPTLDGYERFAIRASQLAQGLPLALVAFGSFLRGATSIDEWEDAIDTLETAPHQNIMDILRSSYTNLDLRDKTIFIRVACLFNGEPVSRVSTLLSETKRRIKGLAEKSLIHISKDGYIDIHSLIKQMAREIVVEESLYIPRQQRILWDPHNSYGVLESKTGTERIQGMTLHMCELPRAASIDGSAFEQMENLIFLKFFKHLNDRESKLNINSKNRMVLPRSLRLLHWDAYPLTTLLPTFPLSRLVELHLRYSNLENLWDGKMSLLELRMLDVTGSKNLTKLPDLSRATKLEELIAKGCTRLEQIPETIGSLPSLKKLDVSHCDRLINLQMIIGELPALQKRSPGLFRQASLSFPDAVVTLNSLTSLAIHGKLNFWLSHLRGKADHLCFSSEQWTPNKFLKQVQKTPKLMSEFYGFKSLDIMQFIYRKDSASFQCYSFSDFLWLTELNLINLNIESIPDDIGLLQVLQKLDLSGNDFTCLPTDMENLSSMKSLRLCNCLKLQTLPKLPQLETLKLSNCILLQSPLGHSAARKDERGYRLAELWLDNCNDVFELSYTFSHCTNLTYLDLSGNDMVTMPVTIRFLRLLNTLCLNDCKKLKSMVQLPPNLTSLYARGCTSLEIIHLPLDHSIKHVDLSYCPKLNEVANLMDRFLRCGRKEEVPQRFACLSGSRVPIYFDYQAREYSREISIPPIWHASEFVGFDACIIIACQSPYHIKLSSSSYSCKQEDNQSYRIDLKPDFVLPPESTRSSNDKEAFSAHHMFIFHVPSNVDFNEFSLEPKLVISEEFQSTPGRIISYGVRVVLKTEEDDRNYDINCGNLSKKRKTDMLTI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ASSSLSSPPPCNYDVFLSFRGEDTRRTIVSHLYAALGAKGIITFKDDQDLEVGDHISSHLRRAIEGSKFAVVVLSERYTTSRWCLMELQLIMELYNLGKLKVLPLFYEVDPSDVRHQRGSFGLERYQGPEFADIVQRWRVALCMVANLSGM

Gene3D: G3DSA:3.40.50.10140
12-122 G3DSA:3.40.50.10140

CNYDVFLSFRGEDTRRTIVSHLYAALGAKGIITFKDDQDLEVGDHISSHLRRAIEGSKFAVVVLSERYTTSRWCLMELQLIMELYNLGKLKVLPLFYEVDPSDVRHQRGSF

ProfileScan: PS50104
IPR000157
12-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

CNYDVFLSFRGEDTRRTIVSHLYAALGAKGIITFKDDQDLEVGDHISSHLRRAIEGSKFAVVVLSERYTTSRWCLMELQLIMELYNLGKLKVLPLFYEVDPSDVRHQRGSFGLERYQGPEFADIVQRWRVALCMVANL

HMMSmart: SM00255
IPR000157
13-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

NYDVFLSFRGEDTRRTIVSHLYAALGAKGIITFKDDQDLEVGDHISSHLRRAIEGSKFAVVVLSERYTTSRWCLMELQLIMELYNLGKLKVLPLFYEVDPSDVRHQRGSFGLERYQGPEFADIVQRWRVALCMVANL

HMMPfam: PF01582
IPR000157
16-126 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRRTIVSHLYAALGAKGIITFKDDQDLEVGDHISSHLRRAIEGSKFAVVVLSERYTTSRWCLMELQLIMELYNLGKLKVLPLFYEVDPSDVRHQRGSFGLER

HMMPanther: PTHR11017
36-1175 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ALGAKGIITFKDDQDLEVGDHISSHLRRAIEGSKFAVVVLSERYTTSRWCLMELQLIMELYNLGKLKVLPLFYEVDPSDVRHQRGSFGLERYQGPEFADIVQRWRVALCMVANLSGMVSRYCADEAMMLEEIVEVISSRLASMQATSFEDLVGMEAHMENIRPLLKKDFDAEVCMVGIWGMGGIGKTTIAKYLYEQLASQFPAHSFIEDVGQICKKVDLKCIQQQLLCDILSTKRVALMSIQNGANLIRSRLGTLKVLFVLDGVDKVEQLHALAKEASWFGPGSRIIITTRDRRLLDSCRVTNKYEVKCLQNEDSLKIVKNIAFAGGVPTLDGYERFAIRASQLAQGLPLALVAFGSFLRGATSIDEWEDAIDTLETAPHQNIMDILRSSYTNLDLRDKTIFIRVACLFNGEPVSRVSTLLSETKRRIKGLAEKSLIHISKDGYIDIHSLIKQMAREIVVEESLYIPRQQRILWDPHNSYGVLESKTGTERIQGMTLHMCELPRAASIDGSAFEQMENLIFLKFFKHLNDRESKLNINSKNRMVLPRSLRLLHWDAYPLTTLLPTFPLSRLVELHLRYSNLENLWDGKMSLLELRMLDVTGSKNLTKLPDLSRATKLEELIAKGCTRLEQIPETIGSLPSLKKLDVSHCDRLINLQMIIGELPALQKRSPGLFRQASLSFPDAVVTLNSLTSLAIHGKLNFWLSHLRGKADHLCFSSEQWTPNKFLKQVQKTPKLMSEFYGFKSLDIMQFIYRKDSASFQCYSFSDFLWLTELNLINLNIESIPDDIGLLQVLQKLDLSGNDFTCLPTDMENLSSMKSLRLCNCLKLQTLPKLPQLETLKLSNCILLQSPLGHSAARKDERGYRLAELWLDNCNDVFELSYTFSHCTNLTYLDLSGNDMVTMPVTIRFLRLLNTLCLNDCKKLKSMVQLPPNLTSLYARGCTSLEIIHLPLDHSIKHVDLSYCPKLNEVANLMDRFLRCGRKEEVPQRFACLSGSRVPIYFDYQAREYSREISIPPIWHASEFVGFDACIIIACQSPYHIKLSSSSYSCKQEDNQSYRIDLKPDFVLPPESTRSSNDKEAFSAHHMFIFHVPSNVDFNEFSLEPKLVISEEFQSTPGRIISYGVRVVLKTEEDDRNYDIN

HMMPanther: PTHR11017:SF20
36-1175 PTHR11017:SF20,SUBFAMILY NOT NAMED

ALGAKGIITFKDDQDLEVGDHISSHLRRAIEGSKFAVVVLSERYTTSRWCLMELQLIMELYNLGKLKVLPLFYEVDPSDVRHQRGSFGLERYQGPEFADIVQRWRVALCMVANLSGMVSRYCADEAMMLEEIVEVISSRLASMQATSFEDLVGMEAHMENIRPLLKKDFDAEVCMVGIWGMGGIGKTTIAKYLYEQLASQFPAHSFIEDVGQICKKVDLKCIQQQLLCDILSTKRVALMSIQNGANLIRSRLGTLKVLFVLDGVDKVEQLHALAKEASWFGPGSRIIITTRDRRLLDSCRVTNKYEVKCLQNEDSLKIVKNIAFAGGVPTLDGYERFAIRASQLAQGLPLALVAFGSFLRGATSIDEWEDAIDTLETAPHQNIMDILRSSYTNLDLRDKTIFIRVACLFNGEPVSRVSTLLSETKRRIKGLAEKSLIHISKDGYIDIHSLIKQMAREIVVEESLYIPRQQRILWDPHNSYGVLESKTGTERIQGMTLHMCELPRAASIDGSAFEQMENLIFLKFFKHLNDRESKLNINSKNRMVLPRSLRLLHWDAYPLTTLLPTFPLSRLVELHLRYSNLENLWDGKMSLLELRMLDVTGSKNLTKLPDLSRATKLEELIAKGCTRLEQIPETIGSLPSLKKLDVSHCDRLINLQMIIGELPALQKRSPGLFRQASLSFPDAVVTLNSLTSLAIHGKLNFWLSHLRGKADHLCFSSEQWTPNKFLKQVQKTPKLMSEFYGFKSLDIMQFIYRKDSASFQCYSFSDFLWLTELNLINLNIESIPDDIGLLQVLQKLDLSGNDFTCLPTDMENLSSMKSLRLCNCLKLQTLPKLPQLETLKLSNCILLQSPLGHSAARKDERGYRLAELWLDNCNDVFELSYTFSHCTNLTYLDLSGNDMVTMPVTIRFLRLLNTLCLNDCKKLKSMVQLPPNLTSLYARGCTSLEIIHLPLDHSIKHVDLSYCPKLNEVANLMDRFLRCGRKEEVPQRFACLSGSRVPIYFDYQAREYSREISIPPIWHASEFVGFDACIIIACQSPYHIKLSSSSYSCKQEDNQSYRIDLKPDFVLPPESTRSSNDKEAFSAHHMFIFHVPSNVDFNEFSLEPKLVISEEFQSTPGRIISYGVRVVLKTEEDDRNYDIN

superfamily: SSF52540
169-418 SSF52540

EVISSRLASMQATSFEDLVGMEAHMENIRPLLKKDFDAEVCMVGIWGMGGIGKTTIAKYLYEQLASQFPAHSFIEDVGQICKKVDLKCIQQQLLCDILSTKRVALMSIQNGANLIRSRLGTLKVLFVLDGVDKVEQLHALAKEASWFGPGSRIIITTRDRRLLDSCRVTNKYEVKCLQNEDSLKIVKNIAFAGGVPTLDGYERFAIRASQLAQGLPLALVAFGSFLRGATSIDEWEDAIDTLETAPHQNI

Gene3D: G3DSA:3.40.50.300
180-226 G3DSA:3.40.50.300

ATSFEDLVGMEAHMENIRPLLKKDFDAEVCMVGIWGMGGIGKTTIAK

HMMPfam: PF00931
IPR002182
190-450 NB-ARC,NBS
NB-ARC

EAHMENIRPLLKKDFDAEVCMVGIWGMGGIGKTTIAKYLYEQLASQFPAHSFIEDVGQICKKVDLKCIQQQLLCDILSTKRVALMSIQNGANLIRSRLGTLKVLFVLDGVDKVEQLHALAKEASWFGPGSRIIITTRDRRLLDSCRVTNKYEVKCLQNEDSLKIVKNIAFAGGVPTLDGYERFAIRASQLAQGLPLALVAFGSFLRGATSIDEWEDAIDTLETAPHQNIMDILRSSYTNLDLRDKTIFIRVACLFNGEPVS

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

MVGIWGMGGIGKTTIA

Gene3D: G3DSA:3.40.50.300
227-333 G3DSA:3.40.50.300

YLYEQLASQFPAHSFIEDVGQICKKVDLKCIQQQLLCDILSTKRVALMSIQNGANLIRSRLGTLKVLFVLDGVDKVEQLHALAKEASWFGPGSRIIITTRDRRLLDS

FPrintScan: PR00364
IPR000767
286-300 DISEASERSIST
Disease resistance protein

RLGTLKVLFVLDGVD

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

AQGLPLALVAFGSFL

superfamily: SSF46785
416-519 SSF46785

QNIMDILRSSYTNLDLRDKTIFIRVACLFNGEPVSRVSTLLSETKRRIKGLAEKSLIHISKDGYIDIHSLIKQMAREIVVEESLYIPRQQRILWDPHNSYGVLE

superfamily: SSF52058
481-999 SSF52058,LRR

DIHSLIKQMAREIVVEESLYIPRQQRILWDPHNSYGVLESKTGTERIQGMTLHMCELPRAASIDGSAFEQMENLIFLKFFKHLNDRESKLNINSKNRMVLPRSLRLLHWDAYPLTTLLPTFPLSRLVELHLRYSNLENLWDGKMSLLELRMLDVTGSKNLTKLPDLSRATKLEELIAKGCTRLEQIPETIGSLPSLKKLDVSHCDRLINLQMIIGELPALQKRSPGLFRQASLSFPDAVVTLNSLTSLAIHGKLNFWLSHLRGKADHLCFSSEQWTPNKFLKQVQKTPKLMSEFYGFKSLDIMQFIYRKDSASFQCYSFSDFLWLTELNLINLNIESIPDDIGLLQVLQKLDLSGNDFTCLPTDMENLSSMKSLRLCNCLKLQTLPKLPQLETLKLSNCILLQSPLGHSAARKDERGYRLAELWLDNCNDVFELSYTFSHCTNLTYLDLSGNDMVTMPVTIRFLRLLNTLCLNDCKKLKSMVQLPPNLTSLYARGCTSLEIIHLPLDHSIKHVDLSYCP

Gene3D: G3DSA:3.80.10.10
572-701 G3DSA:3.80.10.10

INSKNRMVLPRSLRLLHWDAYPLTTLLPTFPLSRLVELHLRYSNLENLWDGKMSLLELRMLDVTGSKNLTKLPDLSRATKLEELIAKGCTRLEQIPETIGSLPSLKKLDVSHCDRLINLQMIIGELPALQ

HMMPfam: PF07725
IPR011713
606-623 LRR_3
Leucine-rich repeat 3

LVELHLRYSNLENLWDGK

FPrintScan: PR00364
IPR000767
671-687 DISEASERSIST
Disease resistance protein

GSLPSLKKLDVSHCDRL

Gene3D: G3DSA:3.80.10.10
805-1004 G3DSA:3.80.10.10

LTELNLINLNIESIPDDIGLLQVLQKLDLSGNDFTCLPTDMENLSSMKSLRLCNCLKLQTLPKLPQLETLKLSNCILLQSPLGHSAARKDERGYRLAELWLDNCNDVFELSYTFSHCTNLTYLDLSGNDMVTMPVTIRFLRLLNTLCLNDCKKLKSMVQLPPNLTSLYARGCTSLEIIHLPLDHSIKHVDLSYCPKLNEV

HMMPfam: PF00560
IPR001611
828-848 LRR_1
Leucine-rich repeat

LQKLDLSGNDFTCLPTDMENL

HMMPfam: PF00560
IPR001611
923-939 LRR_1
Leucine-rich repeat

NLTYLDLSGNDMVTMPV


List of References

H Kotani, Y Nakamura, S Sato, E Asamizu, T Kaneko, N Miyajima, S Tabata
Structural analysis of Arabidopsis thaliana chromosome 5. VI. Sequence features of the regions of 1,367,185 bp covered by 19 physically assigned P1 and TAC clones.
DNA Res.: 1998, 5(3);203-16
PubMed:9734815 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox