PRGDB00046918 (disease resistance protein; strong similarity to TMV resistance protein N)

From PRG Wiki
Jump to: navigation, search
disease resistance protein; strong similarity to TMV resistance protein N
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3702724 (AB018109)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K17N15.

DNA Sequence

ATGGCTTCTTCTTCTTCTCGCAGCTGGACATACGATGTTTTCCCGAGTTTCAGTGGGGAAGATGTCCGTAAATCATTCCTCAGCCACCTTCTCAAGAAGCTTCATCGCAAATCAATCAATACATTCATAGACAACAACATCGAGAGAAGCCACGCGATCGCCCCTGACCTTTTATCCGCGATAAATAACTCGATGATCTCAATCGTGGTATTCTCTAAGAAGTATGCTTCTTCCACCTGGTGCTTGAATGAATTGGTGGAGATCCACAAGTGTTATAAGGAGTTGACTCAAATTGTCATTCCGATTTTCTACGAAGTTGATCCTTCTGATGTTAGAAAGCAAACCAGAGAGTTTGGCGAGTTCTTTAAAGTGACCTGCGTGGGGAAAACAGAAGATGTGAAGCAACAATGGATAGAAGCTCTTGAAGAGGTAGCAAGTATAGCCGGACATGATTCTAAGAATTGGCCTAACGAAGCAAACATGATTGAACATATCGCCAAAGATGTGTTAAATAAACTTATTGCAACATCATCATCGAATTGTTTTGGAGATCTTGTCGGGATCGAAGCTCATTTAAAGGCAGTGAAGTCAATCTTGTGCTTGGAATCTGAGGAAGCAAGAATGGTAGGGATTTTGGGGCCTTCAGGCATTGGTAAGACTACCATAGCTAGAATTTTATACAGTAAGCTCTCTAGCCAATTCGACTATCACGTTTTTGGTTCTTTTAAGAGAACCAACCAGGACAACTATGGCATGAAGTTGAGTTGGGAAGAGCAGTTTCTGTCAGAAATTCTAGATCAAAAGGACCTAAAGATAAGCCAATTAGGTGTGGTGAAACAGAGGCTAAAGCATAAGAAAGTACTTATCGTTCTTGATGATGTGGATAATCTAGAGCTATTAAAGACTTTAGTGGGACAAACCGGGTGGTTTGGACCTGGAAGCAGAATTATCGTGACCACTCAAGATAGGATCCTTCTCAAGTCTCACAAGATTGATCATATTTATGAGGTGGGGTACCCATCGAGAAAATTGGCTCTTCGGATTTTATGTCGATCTGCTTTCGACAGAAACTCCCCACCTGATGGTTTCATGCAGCTTGCAAATGAAGTTACAGAGCTTGTTGGTAATCTTCCTTTGGCTCTCAATATCATGGGTTCGTCTTTGAAAGGGAGGGACAAGGAAGAGTGGATAGAGATGATGCCTAGTCTCCGAAATAGTTTGGTGGATGGAGAAATTCTGAAAACATTAAGAGTCAGCTATGATCGATTACATGGGAATTATCAAGAAATATTCCTTTATATTGCGTGTTTACTAAATTGCTGTGGAGTCGAATACATTATAAGCATGCTTGGAGATAATGCTATCATTGGGTTGAAAATACTGGCTGAGAAGTCCCTCATACATATATCACCACTGGACAAAACTGTAGAGATGCACAGTTTGCTACAAAAGTTGGGTAGAAAGATTGTTCGTGATGAATCCTTTGGAAATCCTGGAAAACGCCGGTTCTTGTTGGATGCTGAGGATATTTGTGATGTATTTACCGATAATACCGGCACAGAAACTGTACTAGGTATATCTCTTAACACATTGGAAATCAACGGGACATTGTCTGTAGATGATAAATCATTCCAAGGTATGCATAATCTCCAATTTCTTAAAGTTTTCGAGAATTGGCGGCGGGGGAGTGGTGAAGGCATATTGTCTTTACCTCAAGGCCTCAATTCTTTGCCCCGAAAACTCAGACTACTACACTGGTATAAATTCCCGTTGAGGTGTATGCCTTCTAACTTCAAGGCCGAGTATCTGGTTAACCTAGAAATGGCGTATAGCCAGCTTGAGAGGTTGTGGGAAGGAACTCAGCAACTTGGAAGTCTCAAGAAGATGGATCTGTCCAAGTCCGAAAATTTGAAAGAAATTCCAGATCTTTCTTACGCCGTAAATCTAGAGGAAATGGATCTTTGCAGTTGTAAATCTTTGGTAACACTTCCTTCCTCAGTTCGAAATCTTGATAAACTTAGGGTGTTAAGAATGAGTAGCTGCTCAAATGTCGAAGTTCTTCCAACTGATCTCAACTTGGAATCTCTCGATCTCCTTAATCTTGAAGATTGCTCACAGTTGAGAAGTTTTCCTCAGATTTCAAGGAACATTTCAATTCTTAATCTAAGTGGAACTGCAATAGACGAAGAAAGTTCTTTATGGATAGAGAATATGTCTAGGCTCACTCATCTCCGCTGGGACTTTTGTCCACTGAAAAGTCTGCCTTCTAACTTTCGTCAAGAACATCTCGTTTCTTTACATATGACACATAGCAAGCTTGAGAAGTTATGGGAAGGAGCCCAGCCTTTTGGAAATCTCGTGAATATTGATCTTTCGCTATCTGAAAAGCTGAAAGAATTTCCAAATCTTTCAAAGGTCACCAATCTCGATACGTTGGATCTTTATGGTTGCAAAAGTTTGGTGACAGTTCCCTCCTCAATTCAGAGTCTCAGTAAGCTGACGGAATTGAACATGAGAAGATGCACAGGTCTCGAGGCTCTTCCTACGGATGTGAACTTGGAATCTCTTCATACTCTAGATCTCAGTGGGTGCTCAAAGTTGACAACTTTTCCTAAGATTTCAAGAAACATTGAACGTCTCCTTCTGGACGACACTGCGATTGAAGAAGTTCCTTCGTGGATTGATGATTTCTTTGAGCTCACTACACTCAGTATGAAAGGTTGCAAGAGGTTAAGAAACATCTCTACAAGCATTTGTGAATTGAAATGTATTGAGGTGGCAAACTTCTCTGACTGTGAAAGACTCACAGAATTTGATGATGCAAGTATGGTAAGAAGAATCTTACGCACCATTGATGATCTGATAGCACTGTACGAGGAGGCTTCATTTCTTCATGCAATATTTGTACTGTGCAGAAAACTCGTATCAATATGTGCAATGGTTTTTAAATATCCCCAAGCTCTCTCTTACTTCTTCAACAGTCCAGAGGCTGATCTCATTTTCGCTAACTGCTCCAGTTTGGATCGAGATGCGGAGACACTCATCCTAGAATCAAATCACGGGTGCGCGGTCTTACCAGGTGGAAAAGTGCCTAACTGTTTCATGAATCAAGCTTGTGGAAGTTCCGTATCTATTCCTTTACATGAGAGCTATTATTCTGAAGAATTTCTTGGCTTTAAGGCTTGCATTGTGCTTGAAACTCCGCCTGACCTGAATTTTAAACAATCGTGGATTTGGGTACGCTGCTATTTCAGAGACAAATGTGTCGAGCATAGTGTCCAGTTTTCCTGGGACTCGAATAAGATGGATCACCTGCTTATGATCAACTTTCGGCTCCCTACAAAAGAAATAATTGGATGTCCATCTCAATTGGACACCGATGACTTGATGTTTTTTTTTTACCACCATATGTATTATGCTTGTAATTCCTACGTAAATCCTTCTCCATGCTCAGTCCAAAGGATAAAAGGATGTGGTATAAAATTTTGGGATGTCTCTCCCAGAGTTCTATCTCAAAGTGAGCTTGATACTTACTTCTCCTGGCCAGTTAAAGGTGAAGGTGAAGCTGAAGGTGAAAGTGAAGGTGAAAGCGAAGACGAACAAGAAGAAGACGAAGATGAAGATGCATATTTGGAGATTGAGGATGACTCGAGCTTGTCGTCGTTTGTGGAGGAGAATATTGGTGAATCTTTTCTAAATACAAACACCTTAGTTCGGTGA


Protein sequences

Name Description Sequence
disease resistance protein; strong similarity to TMV resistance protein N disease resistance protein; strong similarity to TMV resistance protein N [Arabidopsis thaliana].

MASSSSRSWTYDVFPSFSGEDVRKSFLSHLLKKLHRKSINTFIDNNIERSHAIAPDLLSAINNSMISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASIAGHDSKNWPNEANMIEHIAKDVLNKLIATSSSNCFGDLVGIEAHLKAVKSILCLESEEARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDRNSPPDGFMQLANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMMPSLRNSLVDGEILKTLRVSYDRLHGNYQEIFLYIACLLNCCGVEYIISMLGDNAIIGLKILAEKSLIHISPLDKTVEMHSLLQKLGRKIVRDESFGNPGKRRFLLDAEDICDVFTDNTGTETVLGISLNTLEINGTLSVDDKSFQGMHNLQFLKVFENWRRGSGEGILSLPQGLNSLPRKLRLLHWYKFPLRCMPSNFKAEYLVNLEMAYSQLERLWEGTQQLGSLKKMDLSKSENLKEIPDLSYAVNLEEMDLCSCKSLVTLPSSVRNLDKLRVLRMSSCSNVEVLPTDLNLESLDLLNLEDCSQLRSFPQISRNISILNLSGTAIDEESSLWIENMSRLTHLRWDFCPLKSLPSNFRQEHLVSLHMTHSKLEKLWEGAQPFGNLVNIDLSLSEKLKEFPNLSKVTNLDTLDLYGCKSLVTVPSSIQSLSKLTELNMRRCTGLEALPTDVNLESLHTLDLSGCSKLTTFPKISRNIERLLLDDTAIEEVPSWIDDFFELTTLSMKGCKRLRNISTSICELKCIEVANFSDCERLTEFDDASMVRRILRTIDDLIALYEEASFLHAIFVLCRKLVSICAMVFKYPQALSYFFNSPEADLIFANCSSLDRDAETLILESNHGCAVLPGGKVPNCFMNQACGSSVSIPLHESYYSEEFLGFKACIVLETPPDLNFKQSWIWVRCYFRDKCVEHSVQFSWDSNKMDHLLMINFRLPTKEIIGCPSQLDTDDLMFFFYHHMYYACNSYVNPSPCSVQRIKGCGIKFWDVSPRVLSQSELDTYFSWPVKGEGEAEGESEGESEDEQEEDEDEDAYLEIEDDSSLSSFVEENIGESFLNTNTLVR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSRSWTYDVFPSFSGEDVRKSFLSHLLKKLHRKSINTFIDNNIERSHAIAPDLLSAINNSMISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASIAGH

Gene3D: G3DSA:3.40.50.10140
7-144 G3DSA:3.40.50.10140

RSWTYDVFPSFSGEDVRKSFLSHLLKKLHRKSINTFIDNNIERSHAIAPDLLSAINNSMISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEV

ProfileScan: PS50104
IPR000157
9-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WTYDVFPSFSGEDVRKSFLSHLLKKLHRKSINTFIDNNIERSHAIAPDLLSAINNSMISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASI

HMMSmart: SM00255
IPR000157
10-147 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TYDVFPSFSGEDVRKSFLSHLLKKLHRKSINTFIDNNIERSHAIAPDLLSAINNSMISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASI

HMMPfam: PF01582
IPR000157
13-141 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSGEDVRKSFLSHLLKKLHRKSINTFIDNNIERSHAIAPDLLSAINNSMISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEAL

HMMPanther: PTHR11017:SF20
34-1237 PTHR11017:SF20,SUBFAMILY NOT NAMED

LHRKSINTFIDNNIERSHAIAPDLLSAINNSMISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASIAGHDSKNWPNEANMIEHIAKDVLNKLIATSSSNCFGDLVGIEAHLKAVKSILCLESEEARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDRNSPPDGFMQLANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMMPSLRNSLVDGEILKTLRVSYDRLHGNYQEIFLYIACLLNCCGVEYIISMLGDNAIIGLKILAEKSLIHISPLDKTVEMHSLLQKLGRKIVRDESFGNPGKRRFLLDAEDICDVFTDNTGTETVLGISLNTLEINGTLSVDDKSFQGMHNLQFLKVFENWRRGSGEGILSLPQGLNSLPRKLRLLHWYKFPLRCMPSNFKAEYLVNLEMAYSQLERLWEGTQQLGSLKKMDLSKSENLKEIPDLSYAVNLEEMDLCSCKSLVTLPSSVRNLDKLRVLRMSSCSNVEVLPTDLNLESLDLLNLEDCSQLRSFPQISRNISILNLSGTAIDEESSLWIENMSRLTHLRWDFCPLKSLPSNFRQEHLVSLHMTHSKLEKLWEGAQPFGNLVNIDLSLSEKLKEFPNLSKVTNLDTLDLYGCKSLVTVPSSIQSLSKLTELNMRRCTGLEALPTDVNLESLHTLDLSGCSKLTTFPKISRNIERLLLDDTAIEEVPSWIDDFFELTTLSMKGCKRLRNISTSICELKCIEVANFSDCERLTEFDDASMVRRILRTIDDLIALYEEASFLHAIFVLCRKLVSICAMVFKYPQALSYFFNSPEADLIFANCSSLDRDAETLILESNHGCAVLPGGKVPNCFMNQACGSSVSIPLHESYYSEEFLGFKACIVLETPPDLNFKQSWIWVRCYFRDKCVEHSVQFSWDSNKMDHLLMINFRLPTKEIIGCPSQLDTDDLMFFFYHHMYYACNSYVNPSPCSVQRIKGCGIKFWDVSPRVLSQSELDTYFSWPVKGEGEAEGESEGESEDEQEEDEDEDAYLEIEDDSSLSSFVEENIGESFLNTNTL

HMMPanther: PTHR11017
34-1237 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LHRKSINTFIDNNIERSHAIAPDLLSAINNSMISIVVFSKKYASSTWCLNELVEIHKCYKELTQIVIPIFYEVDPSDVRKQTREFGEFFKVTCVGKTEDVKQQWIEALEEVASIAGHDSKNWPNEANMIEHIAKDVLNKLIATSSSNCFGDLVGIEAHLKAVKSILCLESEEARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDRNSPPDGFMQLANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMMPSLRNSLVDGEILKTLRVSYDRLHGNYQEIFLYIACLLNCCGVEYIISMLGDNAIIGLKILAEKSLIHISPLDKTVEMHSLLQKLGRKIVRDESFGNPGKRRFLLDAEDICDVFTDNTGTETVLGISLNTLEINGTLSVDDKSFQGMHNLQFLKVFENWRRGSGEGILSLPQGLNSLPRKLRLLHWYKFPLRCMPSNFKAEYLVNLEMAYSQLERLWEGTQQLGSLKKMDLSKSENLKEIPDLSYAVNLEEMDLCSCKSLVTLPSSVRNLDKLRVLRMSSCSNVEVLPTDLNLESLDLLNLEDCSQLRSFPQISRNISILNLSGTAIDEESSLWIENMSRLTHLRWDFCPLKSLPSNFRQEHLVSLHMTHSKLEKLWEGAQPFGNLVNIDLSLSEKLKEFPNLSKVTNLDTLDLYGCKSLVTVPSSIQSLSKLTELNMRRCTGLEALPTDVNLESLHTLDLSGCSKLTTFPKISRNIERLLLDDTAIEEVPSWIDDFFELTTLSMKGCKRLRNISTSICELKCIEVANFSDCERLTEFDDASMVRRILRTIDDLIALYEEASFLHAIFVLCRKLVSICAMVFKYPQALSYFFNSPEADLIFANCSSLDRDAETLILESNHGCAVLPGGKVPNCFMNQACGSSVSIPLHESYYSEEFLGFKACIVLETPPDLNFKQSWIWVRCYFRDKCVEHSVQFSWDSNKMDHLLMINFRLPTKEIIGCPSQLDTDDLMFFFYHHMYYACNSYVNPSPCSVQRIKGCGIKFWDVSPRVLSQSELDTYFSWPVKGEGEAEGESEGESEDEQEEDEDEDAYLEIEDDSSLSSFVEENIGESFLNTNTL

superfamily: SSF52540
168-409 SSF52540

DVLNKLIATSSSNCFGDLVGIEAHLKAVKSILCLESEEARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDRNSPPDGFMQLANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMMPSLRNSLVD

Gene3D: G3DSA:3.40.50.300
182-220 G3DSA:3.40.50.300

FGDLVGIEAHLKAVKSILCLESEEARMVGILGPSGIGKT

HMMPfam: PF00931
IPR002182
189-442 NB-ARC,NBS
NB-ARC

EAHLKAVKSILCLESEEARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDRNSPPDGFMQLANEVTELVGNLPLALNIMGSSLKGRDKEEWIEMMPSLRNSLVDGEILKTLRVSYDRLHGNYQEIFLYIACLLNCCG

HMMSmart: SM00382
IPR003593
205-341 AAA,NBS
AAA+ ATPase domain

EARMVGILGPSGIGKTTIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPS

FPrintScan: PR00364
IPR000767
208-223 DISEASERSIST
Disease resistance protein

MVGILGPSGIGKTTIA

Gene3D: G3DSA:3.40.50.300
221-356 G3DSA:3.40.50.300

TIARILYSKLSSQFDYHVFGSFKRTNQDNYGMKLSWEEQFLSEILDQKDLKISQLGVVKQRLKHKKVLIVLDDVDNLELLKTLVGQTGWFGPGSRIIVTTQDRILLKSHKIDHIYEVGYPSRKLALRILCRSAFDR

FPrintScan: PR00364
IPR000767
281-295 DISEASERSIST
Disease resistance protein

RLKHKKVLIVLDDVD

FPrintScan: PR00364
IPR000767
374-388 DISEASERSIST
Disease resistance protein

VGNLPLALNIMGSSL

superfamily: SSF46785
410-515 SSF46785

GEILKTLRVSYDRLHGNYQEIFLYIACLLNCCGVEYIISMLGDNAIIGLKILAEKSLIHISPLDKTVEMHSLLQKLGRKIVRDESFGNPGKRRFLLDAEDICDVFT

superfamily: SSF52058
477-758 SSF52058,LRR

EMHSLLQKLGRKIVRDESFGNPGKRRFLLDAEDICDVFTDNTGTETVLGISLNTLEINGTLSVDDKSFQGMHNLQFLKVFENWRRGSGEGILSLPQGLNSLPRKLRLLHWYKFPLRCMPSNFKAEYLVNLEMAYSQLERLWEGTQQLGSLKKMDLSKSENLKEIPDLSYAVNLEEMDLCSCKSLVTLPSSVRNLDKLRVLRMSSCSNVEVLPTDLNLESLDLLNLEDCSQLRSFPQISRNISILNLSGTAIDEESSLWIENMSRLTHLRWDFCPLKSLPSNF

Gene3D: G3DSA:3.80.10.10
575-746 G3DSA:3.80.10.10

NSLPRKLRLLHWYKFPLRCMPSNFKAEYLVNLEMAYSQLERLWEGTQQLGSLKKMDLSKSENLKEIPDLSYAVNLEEMDLCSCKSLVTLPSSVRNLDKLRVLRMSSCSNVEVLPTDLNLESLDLLNLEDCSQLRSFPQISRNISILNLSGTAIDEESSLWIENMSRLTHLRW

HMMPfam: PF07725
IPR011713
602-621 LRR_3
Leucine-rich repeat 3

YLVNLEMAYSQLERLWEGTQ

superfamily: SSF52047
715-936 SSF52047,LRR

RNISILNLSGTAIDEESSLWIENMSRLTHLRWDFCPLKSLPSNFRQEHLVSLHMTHSKLEKLWEGAQPFGNLVNIDLSLSEKLKEFPNLSKVTNLDTLDLYGCKSLVTVPSSIQSLSKLTELNMRRCTGLEALPTDVNLESLHTLDLSGCSKLTTFPKISRNIERLLLDDTAIEEVPSWIDDFFELTTLSMKGCKRLRNISTSICELKCIEVANFSDCERLT

Gene3D: G3DSA:3.80.10.10
747-938 G3DSA:3.80.10.10

DFCPLKSLPSNFRQEHLVSLHMTHSKLEKLWEGAQPFGNLVNIDLSLSEKLKEFPNLSKVTNLDTLDLYGCKSLVTVPSSIQSLSKLTELNMRRCTGLEALPTDVNLESLHTLDLSGCSKLTTFPKISRNIERLLLDDTAIEEVPSWIDDFFELTTLSMKGCKRLRNISTSICELKCIEVANFSDCERLTEF

HMMPfam: PF07725
IPR011713
762-781 LRR_3
Leucine-rich repeat 3

HLVSLHMTHSKLEKLWEGAQ

FPrintScan: PR00364
IPR000767
851-867 DISEASERSIST
Disease resistance protein

VNLESLHTLDLSGCSKL

HMMPfam: PF00560
IPR001611
855-873 LRR_1
Leucine-rich repeat

SLHTLDLSGCSKLTTFPKI


List of References

S Sato, Y Nakamura, T Kaneko, T Katoh, E Asamizu, H Kotani, S Tabata
Structural analysis of Arabidopsis thaliana chromosome 5. X. Sequence features of the regions of 3,076,755 bp covered by sixty P1 and TAC clones.
DNA Res.: 2000, 7(1);31-63
PubMed:10718197 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox